From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1956 [new locus tag: SA_RS11225 ]
  • pan locus tag?: SAUPAN005447000
  • symbol: truncated-SA
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1956 [new locus tag: SA_RS11225 ]
  • symbol: truncated-SA
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2205452..2206111
  • length: 660
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATTATTTATTATACTATGGTTAATTCAGTACAATCATCATATGCAGATAGTACACACCTG
    ATTGGTATTGCTATTACAACTCAAAGCATCATAATCATTGTTGTTTTATTGATTAAAGCA
    ATTATTACTTGGTTATTGTTAATACCTATTTTCAACTTTATGACTAGTTTCGTTGAATCA
    ACTAACGATAAAGTAAAAACACACTTAGCTAATGGATTTAAAGCAATGAAAAATGGTCAA
    AAAACATTTTTCAAATTTTTCATTGGAATACTATTATTAAACTTAATTATTATTTTATTT
    AAAACACCTGTTGGTTACTTGATTTCATTTAATACGCAATCACTCTCTCAAAGTGTTGCA
    GAAAATATCATAAGAGTTTATACAGTAATGACAATCATTTTATTCGTTGTTATTCATGCA
    ATCATTTTAATGGGTATCGTTCAATATTACTTAAAACGTGGTCAAAAAATTACTAAAGAT
    AAAGTAAAAACAGCTGACAAGGATAAAAAAGTTGTCACTGAACCAAAAAATACAAAAGTA
    GAAAATGGTAAAGTGACAACATCTGTTGAAACAAAAACAGAAAAAGCACAAGATTCATTA
    AATGATAATACAACAAAAACGATGACTTCAGATAAACCAGAAGACAATCAACCAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1956 [new locus tag: SA_RS11225 ]
  • symbol: Truncated-SA
  • description: hypothetical protein
  • length: 219
  • theoretical pI: 10.2226
  • theoretical MW: 24677
  • GRAVY: 0.179909

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthetic protein FlhB (TIGR00328; HMM-score: 11.4)
  • TheSEED:  
    Lytic regulatory protein 
  • PFAM:
    no clan definedDUF975; Protein of unknown function (DUF975) (PF06161; HMM-score: 17.5)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 15.8)
    MLANA; Protein melan-A (PF14991; HMM-score: 14.8)
    Mucin; Mucin-like glycoprotein (PF01456; HMM-score: 13.6)
    Bac_export_2; FlhB HrpN YscU SpaS Family (PF01312; HMM-score: 13.1)
    DUF2681; Protein of unknown function (DUF2681) (PF10883; HMM-score: 11.7)
    NDUF_B6; NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit (PF09782; HMM-score: 10.9)
    Tmemb_9; TMEM9 (PF05434; HMM-score: 10.4)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 10)
    no clan definedDUF2663; Protein of unknown function (DUF2663) (PF10864; HMM-score: 6.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.159
    • Ymax_pos: 16
    • Cmax: 0.2
    • Cmax_pos: 16
    • Smax: 0.204
    • Smax_pos: 51
    • Smean: 0.123
    • D: 0.145
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 15927728 NCBI
  • RefSeq: NP_375261 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIYYTMVNSVQSSYADSTHLIGIAITTQSIIIIVVLLIKAIITWLLLIPIFNFMTSFVESTNDKVKTHLANGFKAMKNGQKTFFKFFIGILLLNLIIILFKTPVGYLISFNTQSLSQSVAENIIRVYTVMTIILFVVIHAIILMGIVQYYLKRGQKITKDKVKTADKDKKVVTEPKNTKVENGKVTTSVETKTEKAQDSLNDNTTKTMTSDKPEDNQPK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]