From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005447000
  • symbol?:
  • description?: lytic regulatory protein

      descriptions from strain specific annotations:

    • lytic regulatory protein
    • lytic regulatory protein truncated with Tn554
    • pseudogene
    • membrane-embedded lytic regulatory protein
  • strand?: +
  • coordinates?: 5602956..5610760
  • synteny block?: BlockID0042420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1956 (truncated-SA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2087
    08BA02176:
    C248_2164
    11819-97:
    MS7_2165
    71193:
    ST398NM01_2189
    ECT-R 2:
    ECTR2_2003
    ED133:
    SAOV_2186
    ED98:
    SAAV_2203
    HO 5096 0412:
    SAEMRSA15_20550
    JH1:
    SaurJH1_2221
    JH9:
    SaurJH9_2183
    JKD6008:
    SAA6008_02186
    JKD6159:
    SAA6159_02061
    LGA251:
    SARLGA251_19480
    M013:
    M013TW_2107
    MRSA252:
    SAR2235
    MSHR1132:
    SAMSHR1132_19700
    MSSA476:
    SAS2050
    Mu3:
    SAHV_2131
    Mu50:
    SAV2147
    MW2:
    MW2071
    RF122:
    SAB2031
    ST398:
    SAPIG2189
    T0131:
    SAT0131_02312
    TCH60:
    HMPREF0772_11043
    TW20:
    SATW20_22850
    USA300_TCH1516:
    USA300HOU_2137
    VC40:
    SAVC_09615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIYY--------------------------------------------------------
    NCTC8325        MFTYFKSAFKNAKPQLLITLIYALIAFAVIAVVYLLANFQLAKYAQTIAIYSQFGQKPPV
    Newman          MFTYFKSAFKNAKPQLLITLIYALIAFAVIAVVYLLANFQLAKYAQTIAIYSQFGQKPPV
    USA300_FPR3757  MFTYFKSAFKNAKPQLLITLIYALIAFAVIAVVYLLANFQLAKYAQTIAIYSQFGQKPPV
                    *: *                                                        

    N315            ------------------------------------------------------------
    NCTC8325        DAYLKVIAVLLIAAVVSLFVLVQIFIGITNVMKRAMSHEKVKFTDLFIAFKKGNYLKSVL
    Newman          DAYLKVIAVLLIAAVVSLFVLVQIFIGITNVMKRAMSHEKVKFTDLFIAFKKGNYLKSVL
    USA300_FPR3757  DAYLKVIAVLLIAAVVSLFVLVQIFIGITNVMKRAMSHEKVKFTDLFIAFKKGNYLKSVL
                                                                                

    N315            ----------------------------TMVNSVQSSYADSTHLIGIAITTQSIIIIVVL
    NCTC8325        IGLVSIAMIIVLSLLTSLLYKLFSPVSEMIMNSVQSSYADSTHLIGIAITTQSIIIIVVL
    Newman          IGLVSIAMIIVLSLLTSLLYKLFSPVSEMIMNSVQSSYADSTHLIGIAITTQSIIIIVVL
    USA300_FPR3757  IGLVSIAMIIVLSLLTSLLYKLFSPVSEMIMNSVQSSYADSTHLIGIAITTQSIIIIVVL
                                                 ::*****************************

    N315            LIKAIITWLLLIPIFNFMTSFVESTNDKVKTHLANGFKAMKNGQKTFFKFFIGILLLNLI
    NCTC8325        LIKAIITWLLLIPIFNFMTSFVESTNDKVKTHLANGFKAMKNGQKTFFKFFIGILLLNLI
    Newman          LIKAIITWLLLIPIFNFMTSFVESTNDKVKTHLANGFKAMKNGQKTFFKFFIGILLLNLI
    USA300_FPR3757  LIKAIITWLLLIPIFNFMTSFVESTNDKVKTHLANGFKAMKNGQKTFFKFFIGILLLNLI
                    ************************************************************

    N315            IILFKTPVGYLISFNTQSLSQSVAENIIRVYTVMTIILFVVIHAIILMGIVQYYLKRGQK
    NCTC8325        IILFKTPVGYLISFNTQSLSQSVAENIIRVYTVMTIILFVVIHAIILMGIVQYYLKRGQK
    Newman          IILFKTPVGYLISFNTQSLSQSVAENIIRVYTVMTIILFVVIHAIILMGIVQYYLKRGQK
    USA300_FPR3757  IILFKTPVGYLISFNTQSLSQSVAENIIRVYTVMTIILFVVIHAIILMGIVQYYLKRGQK
                    ************************************************************

    N315            ITKDKVKTADKDKKVVTEPKNTKVENGKVTTSVETKTEKAQDSLNDNTTKTMTSDKPEDN
    NCTC8325        ITKDKVKTADKNKKVVTEPKNTKVENDKVTTSVETKTEKAQDSLNDNTTKTMTSDKPEDN
    Newman          ITKDKVKTADKNKKVVTEPKNTKVENDKVTTSVETKTEKAQDSLNDNTTKTMTSDKPEDN
    USA300_FPR3757  ITKDKVKTADKNKKVVTEPKNTKVENDKVTTSVETKTEKAQDSLNDNTTKTMTSDKPEDN
                    ***********:**************.*********************************

    N315            QPK
    NCTC8325        QPK
    Newman          QPK
    USA300_FPR3757  QPK
                    ***