From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2018 [new locus tag: SA_RS11610 ]
  • pan locus tag?: SAUPAN005669000
  • symbol: truA
  • pan gene symbol?: truA
  • synonym:
  • product: tRNA pseudouridine synthase A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2018 [new locus tag: SA_RS11610 ]
  • symbol: truA
  • product: tRNA pseudouridine synthase A
  • replicon: chromosome
  • strand: -
  • coordinates: 2290918..2291721
  • length: 804
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCGTATATTAGTAGAAATTGCGTATCAAGGAAATAATTTTCTAGGCTTTCAAATTCAA
    CAGAATGGACGTACGGTACAGCAACAATTTGAAAAGCTATTACAACGCATGCATAAAAGA
    CATGTGAGAATCCATCCTTCAAGTAGGACTGATAGAGGTGTACATGCGATACAGCAGTAC
    TTTCATTTCGACACAGAGCTGAATATACCTATGTCACAATGGCAATATGCAATGAACCGA
    ACGTTACCAGATGATATTTATGTCAATAATGTAGTTACAGTCGATGACGATTTTCATTGT
    CGTTACGATTGTGTCGGTAAACGCTATCGATATAAAGTATATCAAGCACAACACCGCGAT
    CCATTTCAAAGTGGTTTGAAAACATTTATTCCTGAAACGTTGGATTTAGACAAAATGAAC
    AGAGCGGCGCAACAATTCATAGGTACACATGATTTTACGGGGTTTTGTTCGCAAAAAACT
    GAAGTAGAAAGCAAAGTTAGAACATTATACCAAAGTGAAATCGTAAAGACAGATGATGGC
    TTTGATTATATTGTCACTGGATCTGGATTTTTATATAACATGGTGCGTGTCTTAGTTGCA
    TTTTTAATAGAAGTTGGAAAAGGGCGACATGAAATTTCTGATGTGCCGAAGCTACTTGAA
    TCAAAGAATCGTAAGAATGTTCCTTTCACTGCACCGGCTGAAGGACTATATTTAGAGAAG
    ATTTATTTAGATGAAAATGAGTTATTAAAAGACTTTGGCAACGATATAAAAATACATCGC
    AAAAAATCATTACAAAATGACTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    804

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2018 [new locus tag: SA_RS11610 ]
  • symbol: TruA
  • description: tRNA pseudouridine synthase A
  • length: 267
  • theoretical pI: 8.42532
  • theoretical MW: 31351.4
  • GRAVY: -0.601873

Function[edit source | edit]

  • reaction:
    EC 5.4.99.12?  ExPASy
    tRNA pseudouridine(38-40) synthasetRNA uridine(38-40) = tRNA pseudouridine(38-40)
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA pseudouridine(38-40) synthase (TIGR00071; EC 5.4.99.12; HMM-score: 221)
    radical SAM-linked protein (TIGR03936; HMM-score: 17.5)
  • TheSEED:  
    Colicin V and Bacteriocin Production Cluster tRNA pseudouridine(38-40) synthase (EC 5.4.99.12) 
    tRNA modification Archaea tRNA pseudouridine(38-40) synthase (EC 5.4.99.12) 
    tRNA processing tRNA pseudouridine(38-40) synthase (EC 5.4.99.12) 
  • PFAM:
    PseudoU_synth (CL0649) PseudoU_synth_1; tRNA pseudouridine synthase (PF01416; HMM-score: 137.5)
    DUF2344; Uncharacterized protein conserved in bacteria (DUF2344) (PF10105; HMM-score: 14.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 44
    • Cmax: 0.112
    • Cmax_pos: 29
    • Smax: 0.215
    • Smax_pos: 39
    • Smean: 0.111
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRILVEIAYQGNNFLGFQIQQNGRTVQQQFEKLLQRMHKRHVRIHPSSRTDRGVHAIQQYFHFDTELNIPMSQWQYAMNRTLPDDIYVNNVVTVDDDFHCRYDCVGKRYRYKVYQAQHRDPFQSGLKTFIPETLDLDKMNRAAQQFIGTHDFTGFCSQKTEVESKVRTLYQSEIVKTDDGFDYIVTGSGFLYNMVRVLVAFLIEVGKGRHEISDVPKLLESKNRKNVPFTAPAEGLYLEKIYLDENELLKDFGNDIKIHRKKSLQND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]