From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2061 [new locus tag: SA_RS11850 ]
  • pan locus tag?: SAUPAN005723000
  • symbol: SA2061
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2061 [new locus tag: SA_RS11850 ]
  • symbol: SA2061
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2324412..2325623
  • length: 1212
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGACTAATCAAGGCTCATTAAATAAATCACCTATTTTCACCAAAAGTTTTACAATCAAC
    TTTTTTGTCAACTTTATCGTATACCTATGCATGTATTTGTTACTTGTAGTTATTGCTGGC
    TATAGTAAGCAAGCTTTCGACGCTTCCGATTCATTAGCCGGATTAGTTGTAGGACTATTT
    ATTGTCGGGTCTTTAATTGGTCGATTTGCTACAGGTAAATTTGTAAATCAAATCGGACCT
    AAACGATTATTATTTATTGGTTTAATTGCTTTAATTATCACGCAATTACTTTATTTTATT
    GATGGATCTTTAGCTTTTTTAATCTTTGTACGTCTCATAAACGGTATCGCAACTGCAGTT
    GTGACAACTGCAACAGGTACTATTGCGGCATACGTTACCCCTGTTAATAGAAAAAGTGAA
    GGCATCAGTTTATTTTCCTTAAGTTTAGTATTAGGTACAGCGATTGGCCCATTTCTAGGC
    ATGTTACTTATTACAAAATACGCAATTGATTTACTGTTTATTATTTGTGTCATATTAGGC
    ATACTCGGACTCATTATCTCATTATTTATAAAAGTTGATTTCGAAGTAACAAATAATAAA
    ACTGAAACTGATGTCATTAATAAACCAAGATTTAGTATTCATCAATTTATTGCAAAAGAG
    GCCATTCCTGTTGCTGTAATTATGCTTTTAATTGGCGTTACCTATGCGTCAATCCTAACT
    TATTTACAAGCATTTGCTTTAGAGCGACACCTAGTCACTGCAGCAAGCTATTTCTTTATT
    TGCTATGCTATAGCATCGTTAATTACTAGACCTATTGCTGGTAGATTGATGGATGATAAA
    AATGAAAATATTATTGTCTATCCAGCATTTATCATGCTTTTCCTTTCATTTGTGTGCTTA
    ATTTCAAGCTATCAAAGCTGGTTAATATTACTTGCTGGTGCTTGCCTAGGTTTAGGGTAT
    GGAAATTTATCATCTGCAATGCAATCTATTGCGATAAAAGTCTCACCCCCGATTAAATAT
    GGTATCGCGACATCTACTTTTTACGTTGGTCTAGATGCAGGTGTCGGCTTCGGTCCATCA
    TTCCTTGGGTTATTTACTCATATGTTTTCATATAGTGAAATCTTCGGCTTTATGGCCGCT
    TTAGCAATCATTACTATGCTTGTTTACTTCTTAATTCATGGACGTCATGTAACTAGAAAT
    GCCATGAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1212

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2061 [new locus tag: SA_RS11850 ]
  • symbol: SA2061
  • description: hypothetical protein
  • length: 403
  • theoretical pI: 9.3132
  • theoretical MW: 43921.2
  • GRAVY: 1.00174

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    multidrug resistance protein (TIGR00880; HMM-score: 72.1)
    Cellular processesCellular processesToxin production and resistancedrug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family (TIGR00711; HMM-score: 53.8)
    MetabolismTransport and binding proteinsOtherdrug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family (TIGR00711; HMM-score: 53.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 45.3)
    MetabolismTransport and binding proteinsAnionsNa(+)-dependent inorganic phosphate cotransporter (TIGR00894; HMM-score: 36)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsH+ Antiporter protein (TIGR00900; HMM-score: 30.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, aromatic acid:H+ symporter (AAHS) family (TIGR00895; HMM-score: 30)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 29.4)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsphosphoglycerate transporter family protein (TIGR00881; HMM-score: 27.9)
    drug resistance transporter, Bcr/CflA subfamily (TIGR00710; HMM-score: 27.4)
    MetabolismTransport and binding proteinsAnionsnitrite transporter (TIGR00886; HMM-score: 21.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidssugar efflux transporter (TIGR00899; HMM-score: 21.4)
  • TheSEED:  
    Major facilitator family transporter 
  • PFAM:
    MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 156.6)
    Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 42.5)
    MFS_1_like; MFS_1 like family (PF12832; HMM-score: 31.8)
    no clan definedDUF5357; Family of unknown function (DUF5357) (PF17310; HMM-score: 7.9)
    MFS (CL0015) MFS_3; Transmembrane secretion effector (PF05977; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 12
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 49
    • Cmax: 0.154
    • Cmax_pos: 45
    • Smax: 0.348
    • Smax_pos: 44
    • Smean: 0.156
    • D: 0.168
  • predicted transmembrane helices (TMHMM): 12

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNQGSLNKSPIFTKSFTINFFVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLFIVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAVVTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILGILGLIISLFIKVDFEVTNNKTETDVINKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILTYLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCLISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPSFLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]