From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2074 [new locus tag: SA_RS11925 ]
  • pan locus tag?: SAUPAN005740000
  • symbol: modA
  • pan gene symbol?: modA
  • synonym:
  • product: molybdate-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2074 [new locus tag: SA_RS11925 ]
  • symbol: modA
  • product: molybdate-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2334301..2335083
  • length: 783
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAATGAAACGTTTTATAGCTATTGTAATGGCATTATTTTTAGTATTAGCTGGTTGC
    TCTAATTCTAACGATAATAATGAAAGTAAAAAAGATGACGCAGACAATGGTAAGAAACAA
    GAGATTCAAGTTGCAGCGGCAGCAAGTTTAACAGATGTAACCAAGAAATTAGCTTCAGAA
    TTTAAAAAAGAGCATAAAAATGCTGATATTAAATTTAACTATGGTGGATCAGGGGCATTA
    AGAAAACAAATTGAATCAGGCGCACCTGTTGACGTATTTATGTCTGCAAATACTAAAGAT
    GTAGATGCATTAAAAGACAAGAATAAAGCGCATGATACATATAAATATGCGAAAAATAGT
    CTAGTATTAATTGGTGATAAAGATTCAAATTACACTTCAGTAAAAGACTTAAAAGACAAT
    GATAAATTAGCATTAGGTGAAGTGAAAACTGTACCAGCAGGAAAATATGCGAAACAGTAT
    TTAGATAACAATAACTTATTTAAAGAAGTCGAAAGTAAAATCGTTTATGCTAAAGATGTA
    AAACAAGTATTAAATTATGTTGAAAAGGGTAATGCGAAACAAGGTTTTGTGTATAAAACT
    GACTTATATAAACAAAACAAAAAAATTGATACTGTAAAAGTAATTAAAGAAGTAGAACTT
    AAGAAACCAATCACATACGAAGCTGGTGCTACATCAGATAGTAAATTAGCAAAAGAGTGG
    ATGGAATTCTTAAAATCAGATAAAGCTAAAGAAATATTAAAAGAATACCACTTTGCAGCA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2074 [new locus tag: SA_RS11925 ]
  • symbol: ModA
  • description: molybdate-binding protein
  • length: 260
  • theoretical pI: 9.79443
  • theoretical MW: 29117.1
  • GRAVY: -0.647308

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, periplasmic molybdate-binding protein (TIGR01256; HMM-score: 184.5)
    MetabolismTransport and binding proteinsAnionsphosphate binding protein (TIGR02136; HMM-score: 37.2)
    tungstate ABC transporter binding protein WtpA (TIGR03730; HMM-score: 34.9)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.5)
  • TheSEED:  
    Molybdenum cofactor biosynthesis Molybdenum ABC transporter, substrate-binding protein ModA 
  • PFAM:
    PBP (CL0177) SBP_bac_11; Bacterial extracellular solute-binding protein (PF13531; HMM-score: 141.2)
    SBP_bac_1; Bacterial extracellular solute-binding protein (PF01547; HMM-score: 53.3)
    PBP_like_2; PBP superfamily domain (PF12849; HMM-score: 25.3)
    no clan definedPilus_CpaD; Pilus biogenesis CpaD protein (pilus_cpaD) (PF09476; HMM-score: 15.5)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 13.5)
    no clan definedTox-REase-7; Restriction endonuclease fold toxin 7 (PF15649; HMM-score: 7.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LVLAGCS
  • SignalP: Signal peptide length 24 aa
    • Ymax: 0.479
    • Ymax_pos: 24
    • Cmax: 0.251
    • Cmax_pos: 24
    • Smax: 0.96
    • Smax_pos: 7
    • Smean: 0.924
    • D: 0.653
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927859 NCBI
  • RefSeq: NP_375392 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKMKRFIAIVMALFLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASEFKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNSLVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDVKQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEWMEFLKSDKAKEILKEYHFAA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]