From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2119 [new locus tag: SA_RS12180 ]
  • pan locus tag?: SAUPAN005813000
  • symbol: SA2119
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2119 [new locus tag: SA_RS12180 ]
  • symbol: SA2119
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2382754..2383635
  • length: 882
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGCAACTCAAGATCCTAGAACAAAATTTAAAACAACGGAATATGAAAAACAAGAACAA
    GAGGTACCGGGTTTACAATCTGAAATGACGCCAGCACCTGATTGTGGCGAAACGTCTTAC
    CAAGGTCATCAACGCTTACAAGGCTATAAAATGTTAGTCACAGGTGGTGACTCAGCAATA
    GGGCGTGCAGCAGCAATTGCGTATGCTAAAGAAGGTGCAGATGTAGCGATTAACTATCTT
    CCGAGTGAAGAACAAGATGCACAAGAAGTACGCCAAGTAATTGAAGAAAGTGGTCAAAAG
    GCAGTGTTAATTCCTGGTGATATAAGAGATGAGCAGTTCAACTATGACCTTGTTGAACAA
    GCATATCAACAATTAGGTGGCTTAGATAATGTTACTTTAGTTGCTGGACATCAACAGTAT
    CATGATGATATTCATGGATTTACAACTGAGGCATTTACAGAAACATTTGAAACGAATGTC
    TATCCGCTATTTTGGACAGTTCAAAAAGCATTGGAATATTTAAAACCGGGTGCGTCAATT
    ACAACGACATCATCTGTACAAGGTTATAATCCTAGTCCTATTCTTCATGATTATGCCGCT
    TCAAAAGCAGCAATTATTTCATTAACTAAAAGTTTTTCAGAAGAATTAGGACCAAAAGGA
    ATTAGAGTGAACTGTGTAGCACCTGGTCCATTCTGGTCACCATTACAAATTTCTGGTGGG
    CAACCTCAAAGTAAAATCCCAACATTTGGTCAAAAAACACCTTTAGGTCGTGCAGGTCAA
    CCTGTTGAGTTATGTGGAACTTATGTGCTATTAGCGTCAGAGGAATCAAGTTATACAACT
    GGACAAGTGTTCGGTGTTAGCGGTGGAGTGCAAATAGATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    882

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2119 [new locus tag: SA_RS12180 ]
  • symbol: SA2119
  • description: hypothetical protein
  • length: 293
  • theoretical pI: 4.39426
  • theoretical MW: 31796.1
  • GRAVY: -0.412969

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 139.7)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 126.8)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 117.9)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 103.9)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 94.2)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 91.8)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 90.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 89.6)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 81.9)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 77.5)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 71.7)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 62.5)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 56.6)
  • TheSEED:  
    Dehydrogenase 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 177.7)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 141.2)
    KR; KR domain (PF08659; HMM-score: 33.3)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 18.4)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 11.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 11
    • Cmax: 0.12
    • Cmax_pos: 70
    • Smax: 0.2
    • Smax_pos: 2
    • Smean: 0.163
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MATQDPRTKFKTTEYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKMLVTGGDSAIGRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQAYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASITTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGGQPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]