From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • pan locus tag?: SAUPAN005883000
  • symbol: SA2158
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • symbol: SA2158
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2425679..2426293
  • length: 615
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
    GATAGTGACCAACAAAAAGACAGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
    CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGACAATAAAGATGATAGTAAA
    GACGTAAACAAAGATAATAAAGATAATAGTGCAAACGATAACCAGCAACAATCTAATTCA
    AATGCAACAAACAATGACCAAAACCAAACAAATAATAACCAATCAAGTAATAATCAAAAA
    TCAAGTTACGTTGCACCATATTATGGACAAAATGCCGCGCCGGTTGCACGTCAAATTTAT
    CCGTTTAATGGAAATAAAACTCAAGCTTTACAGCAATTGCCAAATTTCCAAACAGCTTTA
    AATGCGGCTAATAATGAAGCAAATAAATTTGGTAGTAATAATAAAGTGTATAATGATTAT
    TCTATTGAAGAACATAATGGCAACTATAAGTATGTGTTTAGTTTTAAAGACCCAAATGCA
    AATGGAAAATATTCAATTGTAACGGTTGATTATACTGGACAAGCAATGGTTACTGATCCA
    AACTACCAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • symbol: SA2158
  • description: hypothetical protein
  • length: 204
  • theoretical pI: 5.97547
  • theoretical MW: 22837.3
  • GRAVY: -1.40441

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein ZipA (TIGR02205; HMM-score: 15.3)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 14.5)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9.9)
    MetabolismTransport and binding proteinsCations and iron carrying compoundspotassium uptake protein, Trk family (TIGR00934; HMM-score: 6.8)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 6.3)
    Sec region non-globular protein (TIGR04420; HMM-score: 5.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 5.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 5.1)
  • TheSEED:  
    hypothetical protein similar to TpgX 
  • PFAM:
    no clan definedDUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 21)
    SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 16.8)
    PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 16.6)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 15.8)
    no clan definedNop14; Nop14-like family (PF04147; HMM-score: 15.4)
    MIP-T3; Microtubule-binding protein MIP-T3 (PF10243; HMM-score: 13.1)
    CDC45; CDC45-like protein (PF02724; HMM-score: 12.9)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 11.5)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 11.4)
    no clan definedSAPS; SIT4 phosphatase-associated protein (PF04499; HMM-score: 11.1)
    CLN3; CLN3 protein (PF02487; HMM-score: 11)
    DUF4614; Domain of unknown function (DUF4614) (PF15391; HMM-score: 10.8)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 10.5)
    no clan definedSLC12; Solute carrier family 12 (PF03522; HMM-score: 10.4)
    P-loop_NTPase (CL0023) Hydin_ADK; Hydin Adenylate kinase-like domain (PF17213; HMM-score: 10.4)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 10.3)
    DUF913; Domain of Unknown Function (DUF913) (PF06025; HMM-score: 10.2)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.5)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 9.4)
    CPA_AT (CL0064) Mem_trans; Membrane transport protein (PF03547; HMM-score: 8.6)
    no clan definedTMEM51; Transmembrane protein 51 (PF15345; HMM-score: 7.9)
    MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 7.7)
    TPR (CL0020) Suf; Suppressor of forked protein (Suf) (PF05843; HMM-score: 7.5)
    no clan definedRaftlin; Raftlin (PF15250; HMM-score: 7.2)
    CobT; Cobalamin biosynthesis protein CobT (PF06213; HMM-score: 7)
    Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 7)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 6.4)
    no clan definedDUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 6.2)
    Macoilin; Macoilin family (PF09726; HMM-score: 6)
    Peptidase_PA (CL0124) Peptidase_S64; Peptidase family S64 (PF08192; HMM-score: 5.7)
    Peptidase_CA (CL0125) Menin; Menin (PF05053; HMM-score: 5.6)
    no clan definedGREB1; Gene regulated by oestrogen in breast cancer (PF15782; HMM-score: 4.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: FLAACGQ
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.491
    • Ymax_pos: 27
    • Cmax: 0.308
    • Cmax_pos: 27
    • Smax: 0.947
    • Smax_pos: 18
    • Smean: 0.815
    • D: 0.617
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKRLVTGLLALSLFLAACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQKSSYVAPYYGQNAAPVARQIYPFNGNKTQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]