From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2170 [new locus tag: SA_RS12460 ]
  • pan locus tag?: SAUPAN005907000
  • symbol: SA2170
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2170 [new locus tag: SA_RS12460 ]
  • symbol: SA2170
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2439513..2439935
  • length: 423
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAACTCACAAGCAATTCAAGCAATTGAAAACGTGTTAGCAACGTCAAAAGTTGGT
    GTATTATCAACTGCATATAATAACAAACCTAATAGTAGATATATGGTCTTTTATAATGAT
    GGTCTTACTTTATATACTAAAACGAATATCCATTCTGCTAAGGTCAAAGAAATTAAAGAT
    AATCCAGCAGCATATGTTTTGTTAGGCTATAACGACACAACTAATCGTAGTTTCGTTGAA
    ATGGAAGCCACGATAGAAGTAGTTACTGATCAAAAAGTAATCGATTGGTTATGGGAGACT
    CAAGATAAAAGCTTTTTCAGTTCAAAAGAAGACCCAGAACTTTGTGTTTTAAAGGTGACA
    CCACAATCTGTTAAATTGATGAATGACAAATCATTAGATACACCTATCAAAATCGATTTA
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2170 [new locus tag: SA_RS12460 ]
  • symbol: SA2170
  • description: hypothetical protein
  • length: 140
  • theoretical pI: 4.90619
  • theoretical MW: 15816.9
  • GRAVY: -0.334286

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityPPOX class probable F420-dependent enzyme (TIGR03618; HMM-score: 27.5)
    Unknown functionEnzymes of unknown specificityPPOX class probable F420-dependent enzyme, Rv3369 family (TIGR03667; EC 1.-.-.-; HMM-score: 19.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxamine 5'-phosphate oxidase (TIGR00558; EC 1.4.3.5; HMM-score: 18.2)
    Unknown functionEnzymes of unknown specificityPPOX class probable FMN-dependent enzyme, alr4036 family (TIGR04026; EC 1.-.-.-; HMM-score: 15.7)
  • TheSEED:  
    General stress protein 26 
  • PFAM:
    FMN-binding (CL0336) Putative_PNPOx; Pyridoxamine 5'-phosphate oxidase (PF01243; HMM-score: 56.1)
    Pyrid_ox_like; Pyridoxamine 5'-phosphate oxidase like (PF16242; HMM-score: 54.2)
    Pyridox_ox_2; Pyridoxamine 5'-phosphate oxidase (PF12900; HMM-score: 18.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 26
    • Cmax: 0.137
    • Cmax_pos: 26
    • Smax: 0.395
    • Smax_pos: 14
    • Smean: 0.259
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKDNPAAYVLLGYNDTTNRSFVEMEATIEVVTDQKVIDWLWETQDKSFFSSKEDPELCVLKVTPQSVKLMNDKSLDTPIKIDL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]