From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005907000
  • symbol?:
  • description?: general stress protein

      descriptions from strain specific annotations:

    • general stress protein
    • pyridoxamine 5'-phosphate oxidase-like FMN-binding protein
    • General stress protein 26
    • pyridoxamine 5'-phosphate oxidase family protein
  • strand?: +
  • coordinates?: 5975636..5976058
  • synteny block?: BlockID0046510
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2319
    08BA02176:
    C248_2429
    11819-97:
    MS7_2399
    71193:
    ST398NM01_2435
    ECT-R 2:
    ECTR2_2241
    ED133:
    SAOV_2428
    ED98:
    SAAV_2446
    HO 5096 0412:
    SAEMRSA15_22810
    JH1:
    SaurJH1_2453
    JH9:
    SaurJH9_2406
    JKD6008:
    SAA6008_02421
    JKD6159:
    SAA6159_02284
    LGA251:
    SARLGA251_21660
    M013:
    M013TW_2342
    MRSA252:
    SAR2469
    MSHR1132:
    SAMSHR1132_22090
    MSSA476:
    SAS2272
    Mu3:
    SAHV_2366
    Mu50:
    SAV2382
    MW2:
    MW2302
    RF122:
    SAB2261
    ST398:
    SAPIG2435
    T0131:
    SAT0131_02571
    TCH60:
    HMPREF0772_10806
    TW20:
    SATW20_25120
    USA300_TCH1516:
    VC40:
    SAVC_10775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKD
    N315            MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKD
    NCTC8325        MSNSQAIQAIENVLVTSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKD
    Newman          MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKD
    USA300_FPR3757  MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKD
                    **************.*********************************************

    COL             NPAAYVLLGYNDTTNRSFVEMEATIEIVTEQEVIDWLWETQDKSFFSSKEDPELCVLRVV
    N315            NPAAYVLLGYNDTTNRSFVEMEATIEVVTDQKVIDWLWETQDKSFFSSKEDPELCVLKVT
    NCTC8325        NPAAYVLLGYNDTTNRSFVEMEATIEIVTEQEVIDWLWETQDKSFFSSKEDPELCVLRVV
    Newman          NPAAYVLLGYNDTTNRSFVEMEATIEIVTEQEVIDWLWETQDKSFFSSKEDPELCVLRVV
    USA300_FPR3757  NPAAYVLLGYNDTTNRSFVEMEATIEIVTEQEVIDWLWETQDKSFFSSKEDPELCVLRVV
                    **************************:**:*:*************************:*.

    COL             PQSIKLMNDKSLDTPIKIDL
    N315            PQSVKLMNDKSLDTPIKIDL
    NCTC8325        PQSIKLMNDKSLDTPIKIDL
    Newman          PQSIKLMNDKSLDTPIKIDL
    USA300_FPR3757  PQSIKLMNDKSLDTPIKIDL
                    ***:****************