From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2225 [new locus tag: SA_RS12775 ]
  • pan locus tag?: SAUPAN005985000
  • symbol: SA2225
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2225 [new locus tag: SA_RS12775 ]
  • symbol: SA2225
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2496959..2497765
  • length: 807
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAGATAGGGACAATCGCCGATTTACATATTGATCGTCATAATAAAAAAACATCCGAA
    GATTACTTAGAGGCATTGGTTGAAATAGTTAAGTATAAGAAATTGGATATATTGTTGATT
    GCGGGAGATATCTCAAATCATTATCAATTGACGCACCAATTTATAACGCAATTGACAAAA
    CAATTAGATATACCTGTGAAATTTGTTCCTGGAAACCATGATTTATGGGAAGTTGAAAGT
    ATGACTACGCAAGACATTTGGAATAATTATAAGAGCATGTCACAGTGCTTGGTAGGAAAA
    CCATTTATAGTAAATGAAGAATGGGCAATAATAGGACATACAGGTTGGTATGATTATAGC
    TTTGCAGCACAACGATTTTCATTAGAACATTTACAAAAAGGAAAACATTATGGTGCGACT
    TGGCAAGATAAAGAACGAATATCTTGGGGCATATCAGATCAAAATTTATCTAAAATAGCG
    GCTGAACAAGTGAAGAAAGATATATTAGAAGTAGGAAATAGACGAGTGATTTTAGTCACA
    CATGTTGTGACGCACCCTGATTTCATTGTTCCTATGCCACATCGTATATTCGATTTTTAT
    AATGCATTTATTGGGACAAGTGATTTCAATCCTTTGTATGCGATGTTCGATATACCATAT
    AGTATTATGGGCCATGTTCATTTTCGTAAAAGTGTGATGGATGATGGCAGATGTTATCTC
    TGTCCGTGTCTAGGCTATCCAAGACAATGGCGTTCAGAAGATATTTACCAGGAAATAAAT
    GAGACGATACAAATAATAGAAATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    807

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2225 [new locus tag: SA_RS12775 ]
  • symbol: SA2225
  • description: hypothetical protein
  • length: 268
  • theoretical pI: 6.44351
  • theoretical MW: 31338.7
  • GRAVY: -0.290672

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative phosphoesterase (TIGR03729; HMM-score: 286.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexonuclease SbcCD, D subunit (TIGR00619; HMM-score: 25.2)
    Unknown functionEnzymes of unknown specificityphosphodiesterase, MJ0936 family (TIGR00040; EC 3.1.-.-; HMM-score: 22.3)
    TIGR04168 family protein (TIGR04168; HMM-score: 21.2)
    metallophosphoesterase, DNA ligase-associated (TIGR04123; HMM-score: 20.6)
    Unknown functionEnzymes of unknown specificityputative phosphoesterase (TIGR00024; EC 3.1.-.-; HMM-score: 16.5)
  • TheSEED:  
    Predicted phosphohydrolases 
  • PFAM:
    Calcineurin (CL0163) Metallophos; Calcineurin-like phosphoesterase (PF00149; HMM-score: 48.3)
    Metallophos_2; Calcineurin-like phosphoesterase superfamily domain (PF12850; HMM-score: 41.1)
    Metallophos_3; Metallophosphoesterase, calcineurin superfamily (PF14582; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 44
    • Cmax: 0.112
    • Cmax_pos: 54
    • Smax: 0.107
    • Smax_pos: 32
    • Smean: 0.073
    • D: 0.088
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTKQLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYSFAAQRFSLEHLQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVTHVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVMDDGRCYLCPCLGYPRQWRSEDIYQEINETIQIIEI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA2225 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]