From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005985000
  • symbol?:
  • description?: phosphohydrolase

      descriptions from strain specific annotations:

    • phosphohydrolase
    • calcineurin-like phosphoesterase family protein
    • Metallophosphoesterase
    • putative phosphohydrolase
  • strand?: -
  • coordinates?: 6046153..6046959
  • synteny block?: BlockID0047290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2374
    08BA02176:
    C248_2486
    11819-97:
    MS7_2451
    71193:
    ST398NM01_2489
    ECT-R 2:
    ECTR2_2295
    ED133:
    SAOV_2487c
    ED98:
    SAAV_2503
    HO 5096 0412:
    SAEMRSA15_23370
    JH1:
    SaurJH1_2512
    JH9:
    SaurJH9_2463
    JKD6008:
    SAA6008_02478
    JKD6159:
    SAA6159_02335
    LGA251:
    SARLGA251_22180
    M013:
    M013TW_2400
    MRSA252:
    SAR2527
    MSHR1132:
    SAMSHR1132_22650
    MSSA476:
    SAS2329
    Mu3:
    SAHV_2421
    Mu50:
    SAV2437
    MW2:
    MW2361
    RF122:
    SAB2319c
    ST398:
    SAPIG2489
    T0131:
    SAT0131_02634 (plsX)
    TCH60:
    HMPREF0772_10751
    TW20:
    SATW20_25660
    USA300_TCH1516:
    USA300HOU_2423
    VC40:
    SAVC_11060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTK
    N315            MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTK
    NCTC8325        MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTK
    Newman          MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTK
    USA300_FPR3757  MKIGTIADLHIDRHNKKTSEDYLEALVEIVKYKKLDILLIAGDISNHYQLTHQFITQLTK
                    ************************************************************

    COL             QLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYS
    N315            QLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYS
    NCTC8325        QLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYS
    Newman          QLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYS
    USA300_FPR3757  QLDIPVKFVPGNHDLWEVESMTTQDIWNNYKSMSQCLVGKPFIVNEEWAIIGHTGWYDYS
                    ************************************************************

    COL             FAAQRFSLDELQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVT
    N315            FAAQRFSLEHLQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVT
    NCTC8325        FAAQRFSLDELQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVT
    Newman          FAAQRFSLDELQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVT
    USA300_FPR3757  FAAQRFSLDELQKGKHYGATWQDKERISWGISDQNLSKIAAEQVKKDILEVGNRRVILVT
                    ********:.**************************************************

    COL             HVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVIDDGRCYL
    N315            HVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVMDDGRCYL
    NCTC8325        HVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVIDDGRCYL
    Newman          HVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVIDDGRCYL
    USA300_FPR3757  HVVTHPDFIVPMPHRIFDFYNAFIGTSDFNPLYAMFDIPYSIMGHVHFRKSVIDDGRCYL
                    ****************************************************:*******

    COL             CPCLGYPRQWRSEDIYQEINETIQIIEI
    N315            CPCLGYPRQWRSEDIYQEINETIQIIEI
    NCTC8325        CPCLGYPRQWRSEDIYQEINETIQIIEI
    Newman          CPCLGYPRQWRSEDIYQEINETIQIIEI
    USA300_FPR3757  CPCLGYPRQWRSEDIYQEINETIQIIEI
                    ****************************