From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2317 [new locus tag: SA_RS13280 ]
  • pan locus tag?: SAUPAN006179000
  • symbol: SA2317
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2317 [new locus tag: SA_RS13280 ]
  • symbol: SA2317
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2601700..2602191
  • length: 492
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTCGATGTGCTAAAAAAGAAGATTTAAACGCTATATTAGCGATATACAACGATGCC
    ATTATTAATACAACAGCTGTTTATACTTATAAACCGCAAACCATAGACGAACGTATCGCA
    TGGTTTGAAACGAAACAACGTAATCATGAGCCTATCTTTGTATTTGAGGAAAATGGAAGT
    GTATTAGGGTTTGCGACGTTCGGTTCGTTTAGACCTTGGCCAGCATATCAATATACTATC
    GAGCATTCTATTTATGTCGATGCTTCAGCTAGAGGAAAAGGTATCGCTAGTCAATTATTA
    CAGCGTTTAATTGTAGAGGCAAAAGCTAAAGGTTATCGTACACTTGTTGCTGGTATTGAT
    GCTTCTAATGAAGCGAGTATTAAATTACATCAAAAATTCAATTTCAAGCATGCCGGCACA
    CTGACCAATGTAGGCTATAAATTTGATTACTGGTTAGATTTAGCTTTTTATGAATTAGAT
    TTAAAAGACTAG
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2317 [new locus tag: SA_RS13280 ]
  • symbol: SA2317
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 7.65031
  • theoretical MW: 18654.1
  • GRAVY: -0.234969

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 38)
    Cellular processesCellular processesAdaptations to atypical conditionsdiaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 30.7)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 27.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsmycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 13.6)
    GNAT-family acetyltransferase TIGR03103 (TIGR03103; HMM-score: 10.4)
  • TheSEED:  
    Acetyltransferase, GNAT family 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 79.9)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 64.5)
    Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 51.9)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 39.1)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 37)
    FR47; FR47-like protein (PF08445; HMM-score: 26.4)
    Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 24.2)
    GNAT_acetyltran; GNAT acetyltransferase (PF12746; HMM-score: 23.3)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 17.3)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 14.5)
    Acetyltransf_13; ESCO1/2 acetyl-transferase (PF13880; HMM-score: 14.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 11
    • Cmax: 0.117
    • Cmax_pos: 30
    • Smax: 0.179
    • Smax_pos: 1
    • Smean: 0.124
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA2317 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]