From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
  • pan locus tag?: SAUPAN001143000
  • symbol: SACOL0249
  • pan gene symbol?: bglR
  • synonym:
  • product: GntR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
  • symbol: SACOL0249
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 289279..289983
  • length: 705
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGTTAAAGTATGAACATATTGCTAAGCAACTTAATGCGTTTATACATCAATCTAATTTC
    AAACCCGGTGATAAATTGCCAAGCGTGACGCAATTAAAAGAACGTTATCAAGTAAGTAAG
    AGTACTATCATTAAAGCATTAGGCTTATTGGAACAAGATGGTTTGATCTATCAAGCACAA
    GGCAGTGGTATTTATGTGAGAAATATTGCTGATGCCAATCGTATCAACGTCTTTAAGACT
    AATGGTTTCTCTAAAAGTTTAGGTGAACACCGAATGACAAGTAAGGTACTTGTTTTTAAG
    GAGATTGCAACGCCACCTAAATCTGTACAAGATGAGCTCCAATTAAATGCAGATGATACC
    GTCTACTATTTAGAGCGATTAAGATTCGTGGACGATGATGTTTTATGTATCGAATATTCT
    TATTATCATAAAGAAATCGTGAAATATTTAAATGATGATATTGCTAAGGGCTCTATCTTC
    GACTATTTAGAATCAAACATGAAACTTCGTATTGGTTTTTCAGATATTTTCTTTAATGTA
    GATCAACTCACTTCAAGTGAAGCTTCATTACTACAATTGTCTACAGGTGAACCATGTTTA
    CGTTACCACCAGACTTTTTATACAATGACTGGCAAACCCTTTGATTCATCTGACATCGTA
    TTTCATTATCGTCATGCACAGTTTTATATTCCTAGTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
  • symbol: SACOL0249
  • description: GntR family transcriptional regulator
  • length: 234
  • theoretical pI: 7.67897
  • theoretical MW: 27013.6
  • GRAVY: -0.359829

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstrehalose operon repressor (TIGR02404; HMM-score: 112.2)
    Signal transductionRegulatory functionsDNA interactionsphosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 90.1)
    MetabolismTransport and binding proteinsAnionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    Signal transductionRegulatory functionsDNA interactionsphosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    MetabolismEnergy metabolismAmino acids and amineshistidine utilization repressor (TIGR02018; HMM-score: 66.7)
    Signal transductionRegulatory functionsDNA interactionshistidine utilization repressor (TIGR02018; HMM-score: 66.7)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 27.8)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    MetabolismFatty acid and phospholipid metabolismDegradationfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transductionRegulatory functionsDNA interactionsfatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.9)
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 12.1)
  • TheSEED:  
    Transcriptional regulator, GntR family 
  • PFAM:
    UTRA (CL0122) UTRA; UTRA domain (PF07702; HMM-score: 91.7)
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 61.1)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 22.8)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 21.7)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 16.8)
    HTH_11; HTH domain (PF08279; HMM-score: 16)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 15.4)
    MarR; MarR family (PF01047; HMM-score: 15.3)
    MarR_2; MarR family (PF12802; HMM-score: 15.2)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 14.2)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 13.1)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 53
    • Cmax: 0.108
    • Cmax_pos: 60
    • Smax: 0.163
    • Smax_pos: 43
    • Smean: 0.105
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [1] [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL0249 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SACOL0249 (BglR*)
    BglR* (TF) important in Beta-glucosides utilization  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]