From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001143000
  • symbol?: bglR
  • description?: GntR family transcriptional regulator

      descriptions from strain specific annotations:

    • GntR family transcriptional regulator
    • transcriptional regulator, GntR family protein
    • bacterial regulatory family protein, gntR
    • regulatory proteins, gntR family protein
    • Transcriptional regulator, GntR family
    • UbiC transcription regulator-associated domain-containing protein
    • UbiC transcription regulator-associated domain protein
  • strand?: -
  • coordinates?: 1413905..1420457
  • synteny block?: BlockID0006630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0264
    08BA02176:
    C248_0253
    11819-97:
    MS7_0254
    71193:
    ST398NM01_0278
    ECT-R 2:
    ECTR2_225
    ED133:
    SAOV_0205
    ED98:
    SAAV_0232
    HO 5096 0412:
    SAEMRSA15_02240
    JH1:
    SaurJH1_0255
    JH9:
    SaurJH9_0249
    JKD6008:
    SAA6008_00239
    JKD6159:
    SAA6159_00242
    LGA251:
    SARLGA251_02290
    M013:
    M013TW_0245
    MRSA252:
    SAR0262
    MSHR1132:
    SAMSHR1132_02310
    MSSA476:
    SAS0241
    Mu3:
    SAHV_0263
    Mu50:
    SAV0264
    MW2:
    MW0240
    RF122:
    SAB0203c
    ST398:
    SAPIG0278
    T0131:
    SAT0131_00258
    TCH60:
    HMPREF0772_10237
    TW20:
    SATW20_02670
    USA300_TCH1516:
    USA300HOU_0275
    VC40:
    SAVC_01060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQ
    N315            MLKYEHIAKQLNAFIHQSNFKPGDKLPNVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQ
    NCTC8325        MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQ
    Newman          MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQ
    USA300_FPR3757  MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQ
                    ***************************.********************************

    COL             GSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDT
    N315            GSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEMATPPKSVQDELQLNADDT
    NCTC8325        GSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDT
    Newman          GSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDT
    USA300_FPR3757  GSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDT
                    *****************************************:******************

    COL             VYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNV
    N315            VYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNV
    NCTC8325        VYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNV
    Newman          VYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNV
    USA300_FPR3757  VYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNV
                    ************************************************************

    COL             DQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
    N315            DKLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
    NCTC8325        DQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
    Newman          DQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
    USA300_FPR3757  DQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
                    *:****************************************************