From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0284 [new locus tag: SACOL_RS01440 ]
  • pan locus tag?: SAUPAN001211000
  • symbol: SACOL0284
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0284 [new locus tag: SACOL_RS01440 ]
  • symbol: SACOL0284
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 324867..325478
  • length: 612
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGAGTTCTTATTATTAATTGTCGTAGCCGGACTGTATTATATTATATATTTAACTGCT
    GTGATGTATTCTGAAAAAATAGTAGTATTGCCTATAATCATCTATGCCATTGTGTTTGTA
    ATAATTGGTATCACTTATATCTTTATAGGCGACAGCTATGATCAATTAACAAATTTCAAT
    GTGATTTTGTATATGGGGAGTTTGTTTTATGCATGGATGGCTATTAGAAATCTTTGGAAC
    AGACCACTATTACTAAAATATAAGAACATTACAGATAGTTCAAGTGGAATAGTTAATAAA
    TCTGAATACAATTCAGTTGAAAGCTTACGTATAAATATTGAAATAGCTAAGTATAAAGGG
    ATTATTTCTTTGATAGTAGCTATAGTACTAACGGTATTAATGACATTAAAGTCAACACCT
    CAAATCACTGCAGAAACACGTGACTTAAGTATCTCATTTTTCATACTCAGCTTATTTATC
    ATTATTATATTTGCAGTTTGGGATTTGTTTATTAGAGTTAGAAAAGGAGCGTTTGCTTTT
    GTTGTAATAAGGCCAATATTATTTAGTTGTTGGTTATTTATTTTGAATATGATTTTATCA
    AGATTATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    612

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0284 [new locus tag: SACOL_RS01440 ]
  • symbol: SACOL0284
  • description: hypothetical protein
  • length: 203
  • theoretical pI: 9.5678
  • theoretical MW: 23380.1
  • GRAVY: 1.08867

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108223: hypothetical protein 
  • PFAM:
    no clan definedDUF5080; Domain of unknown function (DUF5080) (PF16883; HMM-score: 340.8)
    Pox_A14; Poxvirus virion envelope protein A14 (PF05767; HMM-score: 16.1)
    PilX_N; PilX N-terminal (PF14341; HMM-score: 6.1)
    Peroxisome (CL0484) Pex24p; Integral peroxisomal membrane peroxin (PF06398; HMM-score: 6)
    no clan definedDUF4579; Domain of unknown function (DUF4579) (PF15158; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.07
    • Ymax_pos: 12
    • Cmax: 0.144
    • Cmax_pos: 24
    • Smax: 0.068
    • Smax_pos: 2
    • Smean: 0.046
    • D: 0.061
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGDSYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAFVVIRPILFSCWLFILNMILSRLL

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]