From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001211000
  • symbol?:
  • description?: DUF5080 domain-containing protein
  • strand?: +
  • coordinates?: 1482655..1484574
  • synteny block?: BlockID0007230
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0295
    08BA02176:
    C248_0284
    11819-97:
    MS7_0286
    71193:
    ST398NM01_0309
    ECT-R 2:
    ECTR2_256
    ED133:
    SAOV_0238
    ED98:
    SAAV_0263
    HO 5096 0412:
    JH1:
    SaurJH1_0286
    JH9:
    SaurJH9_0279
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0271
    Mu3:
    SAHV_0293
    Mu50:
    SAV0296
    MW2:
    MW0271
    RF122:
    SAB0236
    ST398:
    SAPIG0309
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0310
    VC40:
    SAVC_01230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGDSYDQLTNFN
    N315            MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAILFVIIGITYIFIGDSYDQLTNFN
    NCTC8325        MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGDSYDQLTNFN
    Newman          MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGDSYDQLTNFN
    USA300_FPR3757  MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVIIGITYIFIGDSYDQLTNFN
                    *************************************:**********************

    COL             VILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKG
    N315            VILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKG
    NCTC8325        VILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKG
    Newman          VILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKG
    USA300_FPR3757  VILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYNSVESLRINIEIAKYKG
                    ************************************************************

    COL             IISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAF
    N315            IISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAF
    NCTC8325        IISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAF
    Newman          IISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAF
    USA300_FPR3757  IISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLFIRVRKGAFAF
                    ************************************************************

    COL             VVIRPILFSCWLFILNMILSRLL
    N315            VVIRPILFSCWIFILNMILSRLL
    NCTC8325        VVIRPILFSCWLFILNMILSRLL
    Newman          VVIRPILFSCWLFILNMILSRLL
    USA300_FPR3757  VVIRPILFSCWLFILNMILSRLL
                    ***********:***********