From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0307 [new locus tag: SACOL_RS01550 ]
  • pan locus tag?: SAUPAN001233000
  • symbol: pfoR
  • pan gene symbol?:
  • synonym:
  • product: perfringolysin O regulator protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0307 [new locus tag: SACOL_RS01550 ]
  • symbol: pfoR
  • product: perfringolysin O regulator protein
  • replicon: chromosome
  • strand: +
  • coordinates: 340819..341850
  • length: 1032
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGGATTTATTGATAGGTACTTTATTTTTATTTTTGGTCTTAGTGATTTTTACATTATTT
    ACATATAAAGCGCCTAATGGTATGCGTGCCATGGGAGCATTAGCTAATGCAGCAATCGCA
    ACATTTTTAGTGGAAGCATTTAATAAATATGTTGGTGGCGAAGTATTCGGTATTAAATTT
    TTAGAAGAGCTAGGAGACGCTGCGGGAGGTCTAGGTGGTGTCGCTGCCGCTGGATTAACA
    GCATTAGCTATCGGTGTGTCACCAGTATATGCATTAGTTATAGCAGCCGCGTGCGGTGGT
    ATGGATTTATTACCAGGTTTCTTTGCGGGTTATATGATTGGATATGTGATGAAATATACA
    GAGAAATATGTGCCGGATGGTGTCGACTTAATTGGATCGATTGTCATCTTAGCGCCATTA
    GCTCGTCTTATTGCAGTATTATTAACGCCAGTAGTGAATAGTACATTGATTCGAATTGGT
    GATATTATCCAAAGTAGTACGAATACGAATCCAATTATCATGGGTATCATTTTAGGTGGT
    ATTATTACGGTTGTCGGCACAGCGCCATTGAGTTCAATGGCATTGACAGCATTATTAGGT
    TTAACGGGTGTACCTATGGCTATTGGTGCCATGGCAGCATTTAGTTCGGCATTTATGAAT
    GGGACGCTATTCCATCGCTTAAAATTAGGTGATCGTAAGTCTACGATTGCAGTAAGTATT
    GAACCTTTATCACAAGCAGATATTGTATCAGCCAATCCAATTCCAATCTATATTACAAAT
    TTCTTTGGTGGTGCGATTGCTGGTTTAATTATTGCTATGTCAGGTTTAATTAACGATGCG
    ACAGGTACAGCTACACCGATTGCAGGATTTTTAGTTATGTTTGGATTTAATCATCCGACG
    ACAATTGTGATTTATGGTGTAGTAATGGCGATTGTAGGTGCGCTTGCAGGTTATCTTGGT
    TCAATTGTATTTAAAAAATATCCAATTGTTACTAAGCAAGACATGATTAATCGAGGTGCA
    GTAGACGCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1032

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0307 [new locus tag: SACOL_RS01550 ]
  • symbol: PfoR
  • description: perfringolysin O regulator protein
  • length: 343
  • theoretical pI: 6.5239
  • theoretical MW: 35351.9
  • GRAVY: 1.00029

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Perfringolysin O regulator protein PfoR 
  • PFAM:
    PTS_EIIC (CL0493) PTS_EIIC_2; Phosphotransferase system, EIIC (PF13303; HMM-score: 219.4)
    no clan definedHCV_NS4a; Hepatitis C virus non-structural protein NS4a (PF01006; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 8
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.175
    • Ymax_pos: 31
    • Cmax: 0.154
    • Cmax_pos: 31
    • Smax: 0.307
    • Smax_pos: 1
    • Smean: 0.183
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 9

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDLLIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVEAFNKYVGGEVFGIKFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMKYTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIILGGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAVSIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNHPTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA

Experimental data[edit source | edit]

  • experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]