From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0498 [new locus tag: SACOL_RS02515 ]
  • pan locus tag?: SAUPAN002168000
  • symbol: SACOL0498
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0498 [new locus tag: SACOL_RS02515 ]
  • symbol: SACOL0498
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 499247..499921
  • length: 675
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATAAAAAATTAACATCACCGAAAATGACAGTGCCTTTATTTTTAATCGCGCTG
    ATTGTATTTATAGGTATGTTTTACAGTGTAGTGACAAATCAAGAATGGCTTAAAAATATA
    GATATGGGATCATTAACATGGTTTACAGATTATTTCGGTGAGCCACAACGTCAGTATGTT
    AACAATTTGTTTAATTACTATATGACGTTTAGTGCGGAAATTGGAGATGTCAAAGGTGTC
    GTGTTGATTTCCATTATCGTCACAATCATACTGTTTATTAAACAGAGGCATTTAGCGGTT
    TGGTTTGTGACATATTTGGTTTCAGGTGTCATCATGAACAAATTAATTAAAGATACTGTA
    TTACGTCCAAGACCATATAATCATTTAGCCGTTGATACAGGCTTTTCATTTCCGAGTGGA
    CATTCCAACGCCAGCACATTATTATATTTCGCCTTAATGATCATTATTATTTCACTTGCT
    GCTAAGACAATAACAAAAGTGTTGAGTGCGTTGGTTATGGGAATATTATGGCTTAGCATA
    TTATTTTGTCGCCTTTATTTTCATGCACATTACTTTTCAGATGTCATTGGCGGCACGTCA
    CTAGCAATCATTTGGGTAGCGTTATTCTTAATGGTATACCCATACTTTATTAATCATCGA
    CGACAACGCGTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0498 [new locus tag: SACOL_RS02515 ]
  • symbol: SACOL0498
  • description: hypothetical protein
  • length: 224
  • theoretical pI: 9.93343
  • theoretical MW: 25755.6
  • GRAVY: 0.698214

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme exporter protein CcmB (TIGR01190; HMM-score: 14.2)
    MetabolismTransport and binding proteinsOtherheme exporter protein CcmB (TIGR01190; HMM-score: 14.2)
  • TheSEED:  
    PAP2 family phosphatase/haloperoxidase 
  • PFAM:
    pap2 (CL0525) PAP2; PAP2 superfamily (PF01569; HMM-score: 50.7)
    PAP2_3; PAP2 superfamily (PF14378; HMM-score: 17.3)
    no clan definedDUF3671; Protein of unknown function (PF12420; HMM-score: 10.6)
    Fijivirus_P9-2; Fijivirus P9-2 protein (PF06837; HMM-score: 8.6)
    ABC-2 (CL0181) CcmB; CcmB protein (PF03379; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.213
    • Ymax_pos: 11
    • Cmax: 0.137
    • Cmax_pos: 40
    • Smax: 0.568
    • Smax_pos: 4
    • Smean: 0.445
    • D: 0.304
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYVNNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTVLRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSILFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]