From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • pan locus tag?: SAUPAN002199000
  • symbol: SACOL0521
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • symbol: SACOL0521
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 527373..527690
  • length: 318
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGCGCGGTGGCGGAAACATGCAACAAATGATGAAACAAATGCAAAAAATGCAAAAGAAA
    ATGGCTCAAGAACAAGAAAAACTTAAAGAAGAGCGTATTGTAGGAACAGCTGGCGGTGGC
    ATGGTTGCAGTTACTGTAACTGGTCATAAAGAAGTTGTCGACGTTGAAATCAAAGAAGAA
    GCTGTAGACCCAGACGATATTGAAATGCTACAAGACTTAGTGTTAGCAGCTACTAATGAA
    GCGATGAATAAAGCTGATGAGCTTACTCAAGAACGTTTAGGTAAACATACTCAAGGCTTA
    AACATCCCTGGAATGTGA
    60
    120
    180
    240
    300
    318

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • symbol: SACOL0521
  • description: hypothetical protein
  • length: 105
  • theoretical pI: 4.74462
  • theoretical MW: 11597.3
  • GRAVY: -0.619048

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralDNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 100.9)
    MetabolismCentral intermediary metabolismPhosphorus compoundsexopolyphosphatase (TIGR03706; EC 3.6.1.11; HMM-score: 16.5)
    Unknown functionGeneralalpha-NAC homolog (TIGR00264; HMM-score: 9.2)
    Cellular processesCellular processesDNA transformationBacteroides conjugative transposon TraJ protein (TIGR03782; HMM-score: 8.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingmembrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 7.9)
  • TheSEED:  
    DNA processing cluster Nucleoid-associated protein YaaK 
    DNA repair, bacterial RecFOR pathway Nucleoid-associated protein YaaK 
  • PFAM:
    no clan definedYbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 111.6)
    DUF2931; Protein of unknown function (DUF2931) (PF11153; HMM-score: 19.5)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 18.6)
    GIT_CC; GIT coiled-coil Rho guanine nucleotide exchange factor (PF16559; HMM-score: 15.1)
    FKBP_N; Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346; HMM-score: 14.5)
    GADPH_aa-bio_dh (CL0139) Semialdhyde_dhC; Semialdehyde dehydrogenase, dimerisation domain (PF02774; HMM-score: 14.4)
    Glutaminase_I (CL0014) Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 13.6)
    no clan definedDUF2935; Domain of unknown function (DUF2935) (PF11155; HMM-score: 13.2)
    DUF863; Plant protein of unknown function (DUF863) (PF05904; HMM-score: 11.9)
    Oxa1 (CL0376) 60KD_IMP; 60Kd inner membrane protein (PF02096; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.183
    • Ymax_pos: 23
    • Cmax: 0.136
    • Cmax_pos: 23
    • Smax: 0.303
    • Smax_pos: 19
    • Smean: 0.21
    • D: 0.194
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 789 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 41.01 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]