From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0531 [new locus tag: SACOL_RS02715 ]
  • pan locus tag?: SAUPAN002225000
  • symbol: SACOL0531
  • pan gene symbol?: rsmI
  • synonym:
  • product: tetrapyrrole methylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0531 [new locus tag: SACOL_RS02715 ]
  • symbol: SACOL0531
  • product: tetrapyrrole methylase
  • replicon: chromosome
  • strand: +
  • coordinates: 540920..541759
  • length: 840
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGCTGTATTATATTTAGTGGGCACACCAATTGGTAATTTAGCAGATATTACTTATAGA
    GCAGTTGATGTATTGAAACGTGTTGATATGATTGCTTGTGAAGACACTAGAGTAACTAGT
    AAACTGTGTAATCATTATGATATTCCAACTCCATTAAAGTCATATCACGAACATAACAAG
    GATAAGCAGACTGCTTTTATCATTGAACAGTTAGAATTAGGTCTTGACGTTGCGCTCGTA
    TCTGATGCTGGATTGCCCTTAATTAGTGATCCTGGATACGAATTAGTAGTGGCAGCCAGA
    GAAGCTAATATTAAAGTAGAGACTGTGCCTGGACCTAATGCTGGGCTGACGGCTTTGATG
    GCTAGTGGATTACCTTCATATGTATATACATTTTTAGGATTTTTGCCACGAAAAGAGAAA
    GAAAAAAGTGCTGTATTAGAGCAACGTATGCATGAAAATAGCACATTAATTATATACGAA
    TCACCGCATCGTGTGACAGATACATTAAAAACAATTGCAAAGATAGATGCAACACGACAA
    GTATCACTAGGGCGTGAATTAACTAAGAAGTTCGAACAAATTGTAACTGATGATGTAACA
    CAATTACAAGCATTGATTCAGCAAGGCGATGTACCATTGAAAGGCGAATTCGTTATCTTA
    ATTGAAGGTGCTAAAGCGAACAATGAGATATCGTGGTTTGATGATTTATCTATCAATGAG
    CATGTTGATCATTATATTCAAACTTCACAGATGAAACCAAAACAAGCTATTAAAAAAGTT
    GCTGAAGAACGACAACTTAAAACGAATGAAGTATATAATATTTATCATCAAATAAGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0531 [new locus tag: SACOL_RS02715 ]
  • symbol: SACOL0531
  • description: tetrapyrrole methylase
  • length: 279
  • theoretical pI: 5.62169
  • theoretical MW: 31274.6
  • GRAVY: -0.208961

Function[edit source | edit]

  • reaction:
    EC 2.1.1.198?  ExPASy
    16S rRNA (cytidine1402-2'-O)-methyltransferaseS-adenosyl-L-methionine + cytidine1402 in 16S rRNA = S-adenosyl-L-homocysteine + 2'-O-methylcytidine1402 in 16S rRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (cytidine(1402)-2'-O)-methyltransferase (TIGR00096; EC 2.1.1.198; HMM-score: 274.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-4 C11-methyltransferase (TIGR01465; EC 2.1.1.133; HMM-score: 25.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminuroporphyrinogen-III C-methyltransferase (TIGR01469; EC 2.1.1.107; HMM-score: 23.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-2 C(20)-methyltransferase (TIGR01467; EC 2.1.1.130; HMM-score: 20.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-3B C17-methyltransferase (TIGR01466; EC 2.1.1.131; HMM-score: 17.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthernitrogenase MoFe cofactor biosynthesis protein NifE (TIGR01283; HMM-score: 14.1)
    MetabolismCentral intermediary metabolismNitrogen fixationnitrogenase MoFe cofactor biosynthesis protein NifE (TIGR01283; HMM-score: 14.1)
  • TheSEED:  
    Heat shock dnaK gene cluster extended 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) 
  • PFAM:
    no clan definedTP_methylase; Tetrapyrrole (Corrin/Porphyrin) Methylases (PF00590; HMM-score: 116.7)
    Hexosaminidase (CL0546) Glycohydro_20b2; beta-acetyl hexosaminidase like (PF14845; HMM-score: 15.4)
    P-loop_NTPase (CL0023) DNA_pol3_delta; DNA polymerase III, delta subunit (PF06144; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.133
    • Ymax_pos: 22
    • Cmax: 0.13
    • Cmax_pos: 22
    • Smax: 0.194
    • Smax_pos: 14
    • Smean: 0.128
    • D: 0.131
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINEHVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]