From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0551 [new locus tag: SACOL_RS02820 ]
  • pan locus tag?: SAUPAN002248000
  • symbol: SACOL0551
  • pan gene symbol?: divIC
  • synonym:
  • product: cell-division protein divIC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0551 [new locus tag: SACOL_RS02820 ]
  • symbol: SACOL0551
  • product: cell-division protein divIC
  • replicon: chromosome
  • strand: +
  • coordinates: 560545..560937
  • length: 393
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAATAAAGTAGAACATATAGAAAATCAGTACACGTCGCAAGAGAACAAGAAAAAA
    CAACGTCAAAAAATGAAAATGCGTGTTGTTCGTAGGCGTATTACAGTATTTGCGGGCGTA
    TTACTTGCGATAATTGTTGTTTTATCAATCTTGCTTGTTGTCCAAAAACATCGCAATGAT
    ATTGATGCACAGGAGCGAAAAGCGAAAGAAGCACAGTTTCAAAAGCAACAAAATGAAGAA
    ATTGCGTTAAAAGAAAAGTTGAATAATCTGAATGACAAAGATTACATTGAAAAAATTGCG
    CGTGATGATTATTACTTAAGCAACAAAGGTGAAGTGATTTTTAGGTTGCCAGAAGACAAA
    GATTCGTCTAGCTCAAAATCTTCGAAAAAATAA
    60
    120
    180
    240
    300
    360
    393

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0551 [new locus tag: SACOL_RS02820 ]
  • symbol: SACOL0551
  • description: cell-division protein divIC
  • length: 130
  • theoretical pI: 10.4495
  • theoretical MW: 15347.6
  • GRAVY: -0.941538

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 22)
    cytochrome c oxidase accessory protein CcoG (TIGR02745; HMM-score: 16.6)
    TIGR03943 family protein (TIGR03943; HMM-score: 13.3)
    Genetic information processingProtein fateProtein folding and stabilizationcytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
    MetabolismEnergy metabolismElectron transportcytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
  • TheSEED:  
    Bacterial Cell Division Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage 
    Cell division-ribosomal stress proteins cluster Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage 
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 66.4)
    FtsL; Cell division protein FtsL (PF04999; HMM-score: 15.8)
    no clan definedGemini_AL2; Geminivirus AL2 protein (PF01440; HMM-score: 15.5)
    EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 15.2)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 15)
    SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 14.8)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 14.5)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)
    Protocadherin; Protocadherin (PF08374; HMM-score: 13.2)
    DUF1191; Protein of unknown function (DUF1191) (PF06697; HMM-score: 13.1)
    Peptidase_MA (CL0126) Peptidase_M50; Peptidase family M50 (PF02163; HMM-score: 12.7)
    no clan definedINSIG; Insulin-induced protein (INSIG) (PF07281; HMM-score: 11.9)
    GPCR_A (CL0192) 7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 10.8)
    Frizzled; Frizzled/Smoothened family membrane region (PF01534; HMM-score: 10.5)
    MFS (CL0015) TLC; TLC ATP/ADP transporter (PF03219; HMM-score: 10.2)
    no clan definedTraG_N; TraG-like protein, N-terminal region (PF07916; HMM-score: 9.8)
    SNARE-fusion (CL0445) Synaptobrevin; Synaptobrevin (PF00957; HMM-score: 9.7)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.1)
    no clan definedBaculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 9)
    DUF2500; Protein of unknown function (DUF2500) (PF10694; HMM-score: 8.7)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 8.5)
    no clan definedUPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 8.2)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 7.2)
    Oxa1 (CL0376) 60KD_IMP; 60Kd inner membrane protein (PF02096; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.242
    • Ymax_pos: 64
    • Cmax: 0.215
    • Cmax_pos: 64
    • Smax: 0.521
    • Smax_pos: 35
    • Smean: 0.281
    • D: 0.257
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDKDSSSSKSSKK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Signal peptide containing [1] [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]