From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002248000
  • symbol?: divIC
  • description?: cell-division initiation protein

      descriptions from strain specific annotations:

    • cell-division initiation protein
    • cell-division protein divIC
    • septum formation initiator
    • cell-division protein divIC, putative
    • putative cell division protein
    • septum formation initiator family protein
  • strand?: +
  • coordinates?: 2756027..2756419
  • synteny block?: BlockID0015470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0469 (divIC)
    USA300_FPR3757:
    04-02981:
    SA2981_0482
    08BA02176:
    C248_0563
    11819-97:
    MS7_0484
    71193:
    ST398NM01_0573
    ECT-R 2:
    ECTR2_447
    ED133:
    SAOV_0529
    ED98:
    SAAV_0454
    HO 5096 0412:
    SAEMRSA15_04330
    JH1:
    SaurJH1_0542
    JH9:
    SaurJH9_0529
    JKD6008:
    SAA6008_00512 (divIC)
    JKD6159:
    SAA6159_00458 (divIC)
    LGA251:
    SARLGA251_04410
    M013:
    M013TW_0479
    MRSA252:
    SAR0508
    MSHR1132:
    SAMSHR1132_04510
    MSSA476:
    SAS0464
    Mu3:
    SAHV_0504
    Mu50:
    SAV0507
    MW2:
    MW0462
    RF122:
    SAB0456
    ST398:
    SAPIG0573
    T0131:
    SAT0131_00553
    TCH60:
    HMPREF0772_10012
    TW20:
    SATW20_05750
    USA300_TCH1516:
    USA300HOU_0501
    VC40:
    SAVC_02120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRND
    N315            MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRND
    NCTC8325        MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRND
    Newman          MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRND
    USA300_FPR3757  MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRND
                    ************************************************************

    COL             IDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDK
    N315            IDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDK
    NCTC8325        IDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDK
    Newman          IDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDK
    USA300_FPR3757  IDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDK
                    ************************************************************

    COL             DSSSSKSSKK
    N315            DSSSSKSSKK
    NCTC8325        DSSSSKSSKK
    Newman          DSSSSKSSKK
    USA300_FPR3757  DSSSSKSSKK
                    **********