From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0575 [new locus tag: SACOL_RS02985 ]
  • pan locus tag?: SAUPAN002297000
  • symbol: cysE
  • pan gene symbol?: cysE
  • synonym:
  • product: serine acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0575 [new locus tag: SACOL_RS02985 ]
  • symbol: cysE
  • product: serine acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 597897..598538
  • length: 642
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGTTAAAAAGAATGAGAGACGATATAAAAATGGTATTTGAGCAGGATCCAGCGGCACGT
    TCAACATTAGAAGTCATTACAACGTATGCAGGTTTACATGCAGTTTGGAGTCATTTGATT
    GCACATAAGTTATACAACCAAAAAAAATATGTTGCAGCACGCGCGATATCTCAAATTTCA
    AGATTTTTCACAGGTATAGAAATCCATCCAGGTGCTAAAATTGGAAAGCGTCTATTTATA
    GATCATGGTATGGGCGTTGTAATAGGAGAAACATGTACAATTGGTGATAATGTGACAATC
    TATCAAGGCGTGACACTTGGTGGGACAGGGAAAGAAAGAGGGAAAAGACACCCAGATATA
    GGAGACAATGTTTTAATAGCAGCCGGTGCGAAAGTTTTAGGAAATATTAAAATAAATTCA
    AATGTAAATATTGGTGCAAATTCAGTTGTTTTACAATCAGTTCCAAGTTATTCAACGGTT
    GTTGGTATACCAGGACATATTGTTAAGCAAGATGGTGTTCGAGTTGGAAAAACATTTGAT
    CATCGCCATCTACCTGATCCAATTTATGAACAAATTAAGCATTTAGAACGACAACTTGAA
    AAGACTAGGAATGGAGAGATTCAAGATGATTACATTATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    642

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0575 [new locus tag: SACOL_RS02985 ]
  • symbol: CysE
  • description: serine acetyltransferase
  • length: 213
  • theoretical pI: 9.85567
  • theoretical MW: 23527.9
  • GRAVY: -0.196714

Function[edit source | edit]

  • reaction:
    EC 2.3.1.30?  ExPASy
    Serine O-acetyltransferaseAcetyl-CoA + L-serine = CoA + O-acetyl-L-serine
  • TIGRFAM:
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 250.9)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 73.2)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 56.8)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 52.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 39.8)
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 31.7)
    non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 20.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 20.1)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 17.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.6)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.6)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.6)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 8)
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineCysteine Biosynthesis Serine acetyltransferase (EC 2.3.1.30) 
    Lysine, threonine, methionine, and cysteineMethionine Biosynthesis Serine acetyltransferase (EC 2.3.1.30) 
    MiscellaneousPlant-Prokaryote comparative genomicsConserved gene cluster possibly involved in RNA metabolism Serine acetyltransferase (EC 2.3.1.30) 
  • PFAM:
    HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 57.1)
    Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 19.5)
    no clan definedSATase_N; Serine acetyltransferase, N-terminal (PF06426; HMM-score: 18.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 13
    • Cmax: 0.123
    • Cmax_pos: 42
    • Smax: 0.148
    • Smax_pos: 10
    • Smean: 0.137
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKTFDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 61 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]