Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0581 [new locus tag: SACOL_RS03015 ]
- pan locus tag?: SAUPAN002304000
- symbol: secE
- pan gene symbol?: secE
- synonym:
- product: preprotein translocase subunit SecE
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0581 [new locus tag: SACOL_RS03015 ]
- symbol: secE
- product: preprotein translocase subunit SecE
- replicon: chromosome
- strand: +
- coordinates: 602561..602743
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236216 NCBI
- RefSeq: YP_185467 NCBI
- BioCyc: see SACOL_RS03015
- MicrobesOnline: 912061 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAAAAAAGAAAGTTTCTTTAAAGGCGTTAAGTCTGAAATGGAAAAAACAAGTTGG
CCGACGAAAGAAGAGCTATTTAAATATACTGTAATTGTAGTTTCTACTGTTATATTCTTC
TTAGTCTTTTTCTATGCCTTAGATTTAGGAATTACAGCATTGAAAAATTTATTATTTCGT
TAG60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0581 [new locus tag: SACOL_RS03015 ]
- symbol: SecE
- description: preprotein translocase subunit SecE
- length: 60
- theoretical pI: 10.0161
- theoretical MW: 7031.36
- GRAVY: 0.401667
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecE subunit (TIGR00964; HMM-score: 75.8)and 1 moreHAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 11.8)
- TheSEED :
- Preprotein translocase subunit SecE (TC 3.A.5.1.1)
- PFAM: no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 65.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003795
- TAT(Tat/SPI): 0.000127
- LIPO(Sec/SPII): 0.001823
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Integral membrane [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]