Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0617 [new locus tag: SACOL_RS03190 ]
  • pan locus tag?: SAUPAN002347000
  • symbol: SACOL0617
  • pan gene symbol?: hxlA
  • synonym:
  • product: hexulose-6-phosphate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0617 [new locus tag: SACOL_RS03190 ]
  • symbol: SACOL0617
  • product: hexulose-6-phosphate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 650358..650990
  • length: 633
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    GTGGAATTACAATTAGCAATTGATTTATTAAACAAAGAAGACGCGGCTGAGTTAGCAAAT
    AAAGTAAAAGATTATGTAGATATCGTAGAAATCGGTACGCCAATCATTTACAACGAAGGT
    TTACCAGCAGTTAAACATATGGCAGACAACATTAGTAATGTAAAAGTATTAGCAGACATG
    AAAATTATGGATGCAGCTGATTATGAAGTTAGCCAAGCAATTAAATTTGGCGCGGATGTA
    ATTACAATACTAGGTGTTGCAGAAGATGCATCAATTAAAGCAGCTATTGAAGAAGCTCAT
    AAAAATAATAAACAATTACTAGTTGATATGATTGCTGTTCAAGATTTAGAAAAACGTGCA
    AAAGAACTAGATGAAATGGGTGCTGATTATATTGCAGTACACACTGGTTATGATTTACAA
    GCAGAAGGGCAATCACCATTAGAAAGTTTAAGAACCGTTAAATCTGTTATTAAAAATTCT
    AAAGTTGCAGTAGCAGGTGGAATTAAACCAGATACAATTAAAGATATTGTCGCTGAAAGT
    CCTGATCTTGTTATTGTTGGTGGCGGAATCGCAAATGCAGATGATCCAGTAGAAGCTGCA
    AAACAATGTCGCGCTGCAATCGAAGGTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    633

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0617 [new locus tag: SACOL_RS03190 ]
  • symbol: SACOL0617
  • description: hexulose-6-phosphate synthase
  • length: 210
  • theoretical pI: 4.3222
  • theoretical MW: 22435.5
  • GRAVY: -0.0185714

Function[edit source | edit]

  • reaction:
    EC 4.1.2.43?  ExPASy
    3-hexulose-6-phosphate synthaseD-arabino-hex-3-ulose 6-phosphate = D-ribulose 5-phosphate + formaldehyde
  • TIGRFAM:
    3-hexulose-6-phosphate synthase (TIGR03128; EC 4.1.2.43; HMM-score: 297.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotidine 5'-phosphate decarboxylase (TIGR01740; EC 4.1.1.23; HMM-score: 55.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine-phosphate diphosphorylase (TIGR00693; EC 2.5.1.3; HMM-score: 26.5)
    MetabolismEnergy metabolismPentose phosphate pathwayribulose-phosphate 3-epimerase (TIGR01163; EC 5.1.3.1; HMM-score: 21.6)
    phosphoglycerol geranylgeranyltransferase (TIGR01769; EC 2.5.1.41; HMM-score: 11.2)
  • TheSEED:  
    CarbohydratesOne-carbon MetabolismFormaldehyde assimilation: Ribulose monophosphate pathway D-arabino-3-hexulose 6-phosphate formaldehyde-lyase (EC 4.1.2.43) 
  • PFAM:
    TIM_barrel (CL0036) OMPdecase; Orotidine 5'-phosphate decarboxylase / HUMPS family (PF00215; HMM-score: 104.9)
    Ribul_P_3_epim; Ribulose-phosphate 3 epimerase family (PF00834; HMM-score: 20.2)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 15.3)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 15.1)
    PRAI; N-(5'phosphoribosyl)anthranilate (PRA) isomerase (PF00697; HMM-score: 14.9)
    PcrB; PcrB family (PF01884; HMM-score: 13.9)
    ThiG; Thiazole biosynthesis protein ThiG (PF05690; HMM-score: 10.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.106
    • Ymax_pos: 19
    • Cmax: 0.122
    • Cmax_pos: 16
    • Smax: 0.151
    • Smax_pos: 15
    • Smean: 0.094
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADMKIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRAKELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVAVAGGIKPDTIKDIVAESPDLVIVGGGIANADDPVEAAKQCRAAIEGK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3] [4]
    quantitative data / protein copy number per cell: 2206 [5]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [6] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 30.59 h [7]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]