From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • pan locus tag?: SAUPAN002348000
  • symbol: SACOL0618
  • pan gene symbol?: hxlB
  • synonym:
  • product: SIS domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • symbol: SACOL0618
  • product: SIS domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 650992..651540
  • length: 549
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCTAAATTTAGTGACTATCAATTAATTCTAGATGAATTAAAGATGACTTTGTCACAT
    GTTGAAGCGGATGAGTTTTCAACTTTTGCATCCAAAATACTACATGCTGAACATATATTT
    GTAGCTGGCAAAGGACGTTCAGGATTCGTGGCGAATAGTTTTGCAATGCGCTTAAATCAG
    CTCGGCAAACAGGCACATGTTGTTGGAGAATCAACGACACCTGCGATTAAGTCGAATGAT
    GTATTTGTAATTATCTCTGGTTCAGGTTCCACGGAACATTTAAGATTATTAGCAGACAAA
    GCAAAATCAGTAGGTGCTGACATCGTATTAATTACTACAAATAAAGATTCTGCAATAGGC
    AATCTAGCTGGGACGAACATCGTTTTGCCTGCAGGTACAAAATATGATGAACAAGGCTCG
    GCACAACCATTAGGAAGTTTGTTTGAACAAGCATCTCAATTATTTTTAGATAGTGTTGTA
    ATGGGATTGATGACTGAAATGAATGTTACGGAACAAACGATGCAACAAAATCATGCTAAT
    TTAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • symbol: SACOL0618
  • description: SIS domain-containing protein
  • length: 182
  • theoretical pI: 5.19307
  • theoretical MW: 19558.1
  • GRAVY: -0.00274725

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    6-phospho 3-hexuloisomerase (TIGR03127; EC 5.3.-.-; HMM-score: 226.1)
    MetabolismEnergy metabolismSugarssugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 29.7)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanN-acetylmuramic acid 6-phosphate etherase (TIGR00274; EC 4.2.1.126; HMM-score: 23.2)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanglutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    MetabolismCentral intermediary metabolismAmino sugarsglutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    bifunctional phosphoglucose/phosphomannose isomerase (TIGR02128; EC 5.3.1.9; HMM-score: 18)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylglycinamide formyltransferase (TIGR00639; EC 2.1.2.2; HMM-score: 12.2)
  • TheSEED:  
    CarbohydratesOne-carbon MetabolismFormaldehyde assimilation: Ribulose monophosphate pathway 6-phospho-3-hexuloisomerase (EC 5.3.1.27) 
  • PFAM:
    SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 67.6)
    SIS_2; SIS domain (PF13580; HMM-score: 24.6)
    no clan definedFormyl_trans_N; Formyl transferase (PF00551; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.169
    • Ymax_pos: 24
    • Cmax: 0.264
    • Cmax_pos: 24
    • Smax: 0.145
    • Smax_pos: 62
    • Smean: 0.099
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHANLE

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 734 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [5] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 29.99 h [6]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]