From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002348000
  • symbol?: hxlB
  • description?: SIS domain-containing protein

      descriptions from strain specific annotations:

    • SIS domain-containing protein
    • sugar isomerase (SIS)
    • glucose-6-phosphate isomerase
    • putative 6-phospho-3-hexuloisomerase
    • 6-phospho 3-hexuloisomerase
    • Hexulose-6-phosphate isomerase
    • 3-hexulose-6-phosphate isomerase
  • strand?: +
  • coordinates?: 2887361..2887909
  • synteny block?: BlockID0016470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0548
    08BA02176:
    C248_0646
    11819-97:
    MS7_0561 (hxlB)
    71193:
    ST398NM01_0646
    ECT-R 2:
    ECTR2_525 (hxlB)
    ED133:
    SAOV_0606
    ED98:
    SAAV_0534
    HO 5096 0412:
    SAEMRSA15_04980
    JH1:
    SaurJH1_0608
    JH9:
    SaurJH9_0594
    JKD6008:
    SAA6008_00579
    JKD6159:
    SAA6159_00525
    LGA251:
    SARLGA251_05070
    M013:
    M013TW_0559
    MRSA252:
    SAR0575
    MSHR1132:
    SAMSHR1132_05150
    MSSA476:
    SAS0529
    Mu3:
    SAHV_0569
    Mu50:
    SAV0571
    MW2:
    MW0526
    RF122:
    SAB0521
    ST398:
    SAPIG0646 (hxlB)
    T0131:
    SAT0131_00632
    TCH60:
    HMPREF0772_12617 (hxlB)
    TW20:
    SATW20_06410
    USA300_TCH1516:
    USA300HOU_0565
    VC40:
    SAVC_02445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
    N315            MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
    NCTC8325        MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
    Newman          MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
    USA300_FPR3757  MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
                    ************************************************************

    COL             LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
    N315            LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
    NCTC8325        LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
    Newman          LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
    USA300_FPR3757  LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
                    ************************************************************

    COL             NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
    N315            NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
    NCTC8325        NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
    Newman          NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
    USA300_FPR3757  NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
                    ************************************************************

    COL             LE
    N315            LE
    NCTC8325        LE
    Newman          LE
    USA300_FPR3757  LE
                    **