From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0671 [new locus tag: SACOL_RS03470 ]
  • pan locus tag?: SAUPAN002483000
  • symbol: SACOL0671
  • pan gene symbol?:
  • synonym:
  • product: alpha/beta fold family hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0671 [new locus tag: SACOL_RS03470 ]
  • symbol: SACOL0671
  • product: alpha/beta fold family hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 698937..699725
  • length: 789
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAATAAAGTCACAATTAATCCTCAAATCCAATTAACTTATCAAATTGAAGGTAAAGGG
    GATCCTATAATATTACTTCATGGATTGGATGGTAATTTAGCTGGATTTGAAGATTTGCAA
    CATCAACTAGCATCATCATATAAAGTACTTACTTACGATTTAAGAGGTCATGGCAAGTCT
    TCTAAAAGTGAATCATACGATTTAAACGATCACGTTGAGGATTTAAAAATTCTAATGGAG
    AAGTTAAATATTCATGAGGCACATATTCTAGGACATGATTTAGGTGGGGTAGTTGCTAAG
    TTATTTACAGATAAATATGCTTATCGTGTAAAATCATTAACTACCATTGCATCGAAGAAA
    GATGACTTAATACACAGCTTTACTCAATTGTTAATACAATATCAAGATGATATAGCGGGT
    TTTAATAAGTCTGAAGCGTATATTCTTTTATTTTCTAAATTGTTTAGAAATCAAGAGAAG
    ACGATGAAATGGTATCAAAAACAAAGAATATATAGCATTAAGTCTGAGGATGATAGTGCG
    GTGGCAATTCGTTCATTAATTTTGCATAAAGATGAACCTATGTATTTAAAAAAACGTACA
    TGTGTACCTACTTTGTTAATTAATGGGGAACATGATCCTTTGATTAAAGATAAGAATCAT
    TTTAAATTGGAAGCGCATTTTTTAAATGTTACGAAAAAAATCTTCGAACATTCAGGACAT
    GCACCGCATATTGAAGAACCAGAAGCATTTATGAATTATTATTTAAAATTTTTAAAAAGC
    GTATCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    789

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0671 [new locus tag: SACOL_RS03470 ]
  • symbol: SACOL0671
  • description: alpha/beta fold family hydrolase
  • length: 262
  • theoretical pI: 7.9427
  • theoretical MW: 30215.5
  • GRAVY: -0.41374

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismOther3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 78.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 76.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinpimelyl-[acyl-carrier protein] methyl ester esterase (TIGR01738; EC 3.1.1.85; HMM-score: 72.9)
    pyrimidine utilization protein D (TIGR03611; HMM-score: 68.1)
    proline-specific peptidase (TIGR01250; HMM-score: 59.7)
    MetabolismEnergy metabolismPhotosynthesisputative magnesium chelatase accessory protein (TIGR03056; HMM-score: 47.9)
    prolyl aminopeptidase (TIGR01249; EC 3.4.11.5; HMM-score: 35.3)
    2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (TIGR03343; EC 3.7.1.-; HMM-score: 34)
    MetabolismEnergy metabolismOtherpoly(3-hydroxyalkanoate) depolymerase (TIGR02240; EC 3.1.1.-; HMM-score: 27.1)
    MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferase (TIGR01392; EC 2.3.1.31; HMM-score: 13.2)
  • TheSEED:  
    hypothetical esterase/lipase [EC:3.1.-.-] 
  • PFAM:
    AB_hydrolase (CL0028) Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 100.5)
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 61.2)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 54.5)
    PGAP1; PGAP1-like protein (PF07819; HMM-score: 20.9)
    FSH1; Serine hydrolase (FSH1) (PF03959; HMM-score: 20.6)
    Ndr; Ndr family (PF03096; HMM-score: 17.8)
    DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 16.6)
    Abhydrolase_5; Alpha/beta hydrolase family (PF12695; HMM-score: 16.4)
    Abhydrolase_4; TAP-like protein (PF08386; HMM-score: 14.1)
    Thioesterase; Thioesterase domain (PF00975; HMM-score: 12.4)
    Lipase_3; Lipase (class 3) (PF01764; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 21
    • Cmax: 0.125
    • Cmax_pos: 45
    • Smax: 0.176
    • Smax_pos: 15
    • Smean: 0.117
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKSSKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKKDDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSAVAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGHAPHIEEPEAFMNYYLKFLKSVS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [4] [5] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]