From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002483000
  • symbol?:
  • description?: alpha/beta hydrolase

      descriptions from strain specific annotations:

    • alpha/beta hydrolase
    • alpha/beta fold family hydrolase
    • alpha/beta hydrolase fold family hydrolase
    • alpha/beta hydrolase fold family protein
    • Esterase
    • esterase/lipase
    • esterase or lipase
    • Hydrolase
    • hydrolase, alpha/beta hydrolase fold family
    • hypothetical esterase/lipase
    • putative esterase
    • putative esterase/lipase
  • strand?: +
  • coordinates?: 3000806..3001594
  • synteny block?: BlockID0017190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0592
    08BA02176:
    C248_0699
    11819-97:
    MS7_0668
    71193:
    ST398NM01_0696
    ECT-R 2:
    ECTR2_568
    ED133:
    SAOV_0651
    ED98:
    SAAV_0579
    HO 5096 0412:
    SAEMRSA15_05430
    JH1:
    SaurJH1_0653
    JH9:
    SaurJH9_0638
    JKD6008:
    SAA6008_00633
    JKD6159:
    SAA6159_00572
    LGA251:
    SARLGA251_05510
    M013:
    M013TW_0604
    MRSA252:
    SAR0624
    MSHR1132:
    SAMSHR1132_05590
    MSSA476:
    SAS0583
    Mu3:
    SAHV_0613
    Mu50:
    SAV0615
    MW2:
    MW0579
    RF122:
    SAB0568
    ST398:
    SAPIG0696
    T0131:
    SAT0131_00683
    TCH60:
    HMPREF0772_12571
    TW20:
    SATW20_06920
    USA300_TCH1516:
    USA300HOU_0621
    VC40:
    SAVC_02720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
    N315            MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
    NCTC8325        MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
    Newman          MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
    USA300_FPR3757  MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
                    ************************************************************

    COL             SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
    N315            SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
    NCTC8325        SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
    Newman          SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
    USA300_FPR3757  SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
                    ************************************************************

    COL             DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
    N315            DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
    NCTC8325        DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
    Newman          DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
    USA300_FPR3757  DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
                    ************************************************************

    COL             VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
    N315            VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
    NCTC8325        VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
    Newman          VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
    USA300_FPR3757  VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
                    ************************************************************

    COL             APHIEEPEAFMNYYLKFLKSVS
    N315            APHIEEPEAFMNYYLNFLKSVS
    NCTC8325        APHIEEPEAFMNYYLKFLKSVS
    Newman          APHIEEPEAFMNYYLKFLKSVS
    USA300_FPR3757  APHIEEPEAFMNYYLKFLKSVS
                    ***************:******