From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0716 [new locus tag: SACOL_RS03685 ]
  • pan locus tag?: SAUPAN002538000
  • symbol: SACOL0716
  • pan gene symbol?: graR
  • synonym:
  • product: DNA-binding response regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0716 [new locus tag: SACOL_RS03685 ]
  • symbol: SACOL0716
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 740479..741162
  • length: 684
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    GTGATATGGATGCAAATACTACTAGTAGAAGATGACAATACTTTGTTTCAAGAATTGAAA
    AAAGAATTAGAACAATGGGATTTTAATGTTGCTGGTATTGAAGATTTCGGCAAAGTAATG
    GATACATTTGAAAGTTTTAATCCTGAAATTGTTATATTGGATGTTCAATTACCTAAATAT
    GATGGGTTTTATTGGTGCAGAAAAATGAGAGAAGTTTCCAACGTACCAATATTATTTTTA
    TCATCTCGTGATAATCCAATGGATCAAGTGATGAGTATGGAACTTGGCGCAGATGATTAT
    ATGCAAAAACCGTTCTATACCAATGTATTAATTGCTAAATTACAAGCGATTTATCGTCGT
    GTCTATGAGTTTACAGCTGAAGAAAAACGTACATTGACTTGGCAAGATGCTGTCGTTGAT
    CTATCAAAAGATAGTATACAAAAAGGTGATCAGACGATTTTCCTGTCCAAAACAGAAATG
    ATTATATTAGAAATTCTTATTACCAAAAAAAATCAAATCGTTTCGAGAGATACAATTATC
    ACTGCATTATGGGATGATGAAGCATTTGTTAGTGATAATACGTTAACAGTAAATGTGAAT
    CGTTTACGAAAAAAATTATCTGAAATTAGTATGGATAGTGCAATCGAAACAAAAGTAGGA
    AAAGGATATATGGCTCATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    684

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0716 [new locus tag: SACOL_RS03685 ]
  • symbol: SACOL0716
  • description: DNA-binding response regulator
  • length: 227
  • theoretical pI: 4.39684
  • theoretical MW: 26509.3
  • GRAVY: -0.229956

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 146.8)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 146.8)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 118.2)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 116.8)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 44.9)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 44.9)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 44.9)
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 44.3)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 38)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 19.8)
  • TheSEED:  
    Virulence, Disease and DefenseBacteriocins, ribosomally synthesized antibacterial peptidesBacitracin Stress Response Two-component response regulator BceR 
  • PFAM:
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 76.7)
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 76.7)
    POTRA (CL0191) POTRA_1; POTRA domain, FtsQ-type (PF08478; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 27
    • Cmax: 0.105
    • Cmax_pos: 27
    • Smax: 0.127
    • Smax_pos: 8
    • Smean: 0.089
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIWMQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRRVYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 51 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Michael Meehl, Silvia Herbert, Friedrich Götz, Ambrose Cheung
Interaction of the GraRS two-component system with the VraFG ABC transporter to support vancomycin-intermediate resistance in Staphylococcus aureus.
Antimicrob. Agents Chemother.: 2007, 51(8);2679-89
[PubMed:17502406] [WorldCat.org] [DOI] (P p)