From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002538000
  • symbol?: graR
  • description?: response regulator protein

      descriptions from strain specific annotations:

    • response regulator protein
    • two component transcriptional regulator
    • response regulator receiver
    • two-component response regulator
    • DNA-binding response regulator
    • Two-component response regulator BceR
    • DNA-binding response regulator GraR
    • response regulator protein GraR
    • winged helix family two component transcriptional regulator
    • putative response regulator protein
    • YtsA
  • strand?: +
  • coordinates?: 3049136..3049819
  • synteny block?: BlockID0017740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0635 (bceR)
    08BA02176:
    C248_0743
    11819-97:
    MS7_0709 (graR)
    71193:
    ST398NM01_0737
    ECT-R 2:
    ECTR2_610
    ED133:
    SAOV_0693
    ED98:
    SAAV_0621
    HO 5096 0412:
    SAEMRSA15_05850
    JH1:
    SaurJH1_0697
    JH9:
    SaurJH9_0682
    JKD6008:
    SAA6008_00675 (graR)
    JKD6159:
    SAA6159_00613 (graR)
    LGA251:
    SARLGA251_05920 (graR)
    M013:
    M013TW_0646
    MRSA252:
    SAR0669
    MSHR1132:
    SAMSHR1132_06050
    MSSA476:
    SAS0624
    Mu3:
    SAHV_0656 (graR)
    Mu50:
    SAV0659
    MW2:
    MW0621
    RF122:
    SAB0608
    ST398:
    SAPIG0737
    T0131:
    SAT0131_00729
    TCH60:
    HMPREF0772_12529
    TW20:
    SATW20_07340 (graR)
    USA300_TCH1516:
    USA300HOU_0680
    VC40:
    SAVC_02925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIWMQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKY
    N315            ---MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKY
    NCTC8325        ---MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKY
    Newman          ---MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKY
    USA300_FPR3757  ---MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKY
                       *********************************************************

    COL             DGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRR
    N315            DGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRR
    NCTC8325        DGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRR
    Newman          DGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRR
    USA300_FPR3757  DGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYTNVLIAKLQAIYRR
                    ************************************************************

    COL             VYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTII
    N315            VYEFTAEEKRTLTWQDAVVDLSKDSIQKGDDTIFLSKTEMIILEILITKKNQIVSRDTII
    NCTC8325        VYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTII
    Newman          VYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTII
    USA300_FPR3757  VYEFTAEEKRTLTWQDAVVDLSKDSIQKGDQTIFLSKTEMIILEILITKKNQIVSRDTII
                    ******************************:*****************************

    COL             TALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
    N315            TALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
    NCTC8325        TALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
    Newman          TALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
    USA300_FPR3757  TALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMAHE
                    ***********************************************