From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
  • pan locus tag?: SAUPAN002597000
  • symbol: SACOL0771
  • pan gene symbol?: queD
  • synonym:
  • product: 6-pyruvoyl tetrahydrobiopterin synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
  • symbol: SACOL0771
  • product: 6-pyruvoyl tetrahydrobiopterin synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 792382..792801
  • length: 420
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTACAACAAATCTATCCTAGTACAACGCATCCATATCAATTCGAATTAAATAAAGAT
    TTTAATTTTTCGGCTGCACATCACATTCCATGTGAAGAAGCAGGTATTTGTCAAAATGTC
    CATGGTCATACTTACTTTGTTAATTTAACAATTGTCGGTGATAAACTAGATGACACTGGC
    TTCTTAGTGAACTTTAGCCATTTGAAAAAGATGATACACGGTAAATTTGACCATCAACTG
    TTAAATAACTTACCTGCTTTTAAAAACAAAATCCCTTCAACTGAAATCGTAGCGGAAACA
    ATTTATCAAATTGTTAAAGAAAATTTGGCATCGCTCGAACACCAACCAAAATGTATTCAA
    GTATTTGTAAGAGAAACACCAACAAGTTATGTCGTATTTAGACCAAAGGAACAGGTGTAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
  • symbol: SACOL0771
  • description: 6-pyruvoyl tetrahydrobiopterin synthase
  • length: 139
  • theoretical pI: 7.01376
  • theoretical MW: 16011.2
  • GRAVY: -0.274101

Function[edit source | edit]

  • reaction:
    EC 4.-.-.-?  ExPASy
    7,8-dihydroneopterin 3'-triphosphate + H2O = 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate?
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification6-pyruvoyl tetrahydropterin synthase/QueD family protein (TIGR00039; HMM-score: 100.7)
    Genetic information processingProtein synthesistRNA and rRNA base modificationqueuosine biosynthesis protein QueD (TIGR03367; HMM-score: 93.8)
    6-pyruvoyl tetrahydropterin synthase-related domain (TIGR03112; HMM-score: 30.8)
  • TheSEED:  
    Queuosine-Archaeosine Biosynthesis 6-carboxytetrahydropterin synthase (EC 4.1.2.50) 
  • PFAM:
    THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 105.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 35
    • Cmax: 0.145
    • Cmax_pos: 43
    • Smax: 0.207
    • Smax_pos: 24
    • Smean: 0.127
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSYVVFRPKEQV

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [1]
    quantitative data / protein copy number per cell: 73 [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [3] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 15.91 h [4]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]