From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002597000
  • symbol?: queD
  • description?: 6-carboxytetrahydropterin synthase QueD

      descriptions from strain specific annotations:

    • 6-carboxytetrahydropterin synthase QueD
    • 6-pyruvoyl tetrahydropterin synthase
    • 6-pyruvoyl tetrahydrobiopterin synthase
    • 6-pyruvoyl tetrahydrobiopterin synthase-like protein
    • 6-pyruvoyl tetrahydrobiopterin synthase, putative
    • 6-pyruvoyl tetrahydrobiopterin synthase homologue
    • putative 6-pyruvoyl tetrahydropterin synthase
    • queuosine biosynthesis protein QueD
    • Queuosine biosynthesis QueD, PTPS-I
  • strand?: -
  • coordinates?: 3107853..3108272
  • synteny block?: BlockID0018330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0688 (queD)
    08BA02176:
    C248_0795
    11819-97:
    MS7_0762 (queD)
    71193:
    ST398NM01_0788
    ECT-R 2:
    ECTR2_662 (queD)
    ED133:
    SAOV_0745c
    ED98:
    SAAV_0673
    HO 5096 0412:
    SAEMRSA15_06370
    JH1:
    SaurJH1_0751
    JH9:
    SaurJH9_0735
    JKD6008:
    SAA6008_00727
    JKD6159:
    SAA6159_00666
    LGA251:
    SARLGA251_06440
    M013:
    M013TW_0697
    MRSA252:
    SAR0764
    MSHR1132:
    SAMSHR1132_06560
    MSSA476:
    SAS0676
    Mu3:
    SAHV_0708
    Mu50:
    SAV0711
    MW2:
    MW0673
    RF122:
    SAB0660c
    ST398:
    SAPIG0788
    T0131:
    SAT0131_00781
    TCH60:
    HMPREF0772_12476 (ygcM)
    TW20:
    SATW20_07860
    USA300_TCH1516:
    USA300HOU_0734
    VC40:
    SAVC_03190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTG
    N315            MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTG
    NCTC8325        MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTG
    Newman          MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTG
    USA300_FPR3757  MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTG
                    ************************************************************

    COL             FLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQ
    N315            FLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQ
    NCTC8325        FLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQ
    Newman          FLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQ
    USA300_FPR3757  FLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQ
                    ************************************************************

    COL             VFVRETPTSYVVFRPKEQV
    N315            VFVRETPTSYVVFRPKEQV
    NCTC8325        VFVRETPTSYVVFRPKEQV
    Newman          VFVRETPTSYVVFRPKEQV
    USA300_FPR3757  VFVRETPTSYVVFRPKEQV
                    *******************