From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0802 [new locus tag: SACOL_RS04125 ]
  • pan locus tag?: SAUPAN002644000
  • symbol: SACOL0802
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0802 [new locus tag: SACOL_RS04125 ]
  • symbol: SACOL0802
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 825155..825673
  • length: 519
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTATTCAAATGTTCAACCATTCATTAATAGTGATTTAACTAATTGTTTTCAATCACAA
    TACACTGAAATTGAATCATTATTATTCAACCTCTTAGACAGCCCAGTAAAATATACAAAA
    CATATTGGCGGTACGCATCATTTTAAATATTCAACAGAGCCAATTTTAGATATTTTAGTA
    GGTGTAGAAAATTTGCATGATATTACATCCTTAGATGAAAAACGCTTAAATTATGTAGGG
    TTTTATCGTTTGCATCATAAATATACTAAGAAAGTTATGATGGCGAAGTTTAACAATTTT
    CATGAACTAAAACAACAGGTGCGTCTACATATCATTCAAATGAATACCCAAACATTTGAA
    TCTTATCTTGCACTTGATTACCTCTTATCAACTAATGATGATATTGCTTTGCAATTCAAT
    ACAAAAAAACACCAAATATTGCAACATAGCTTAACAATTAGACAATATGAGATGCAAAAG
    CAACAATACTTTGAAAAACTATGTAAAAAATACTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    519

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0802 [new locus tag: SACOL_RS04125 ]
  • symbol: SACOL0802
  • description: hypothetical protein
  • length: 172
  • theoretical pI: 8.60072
  • theoretical MW: 20605.5
  • GRAVY: -0.485465

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108570: hypothetical protein 
  • PFAM:
    NTP_transf (CL0260) GrpB; GrpB protein (PF04229; HMM-score: 75.5)
    no clan definedT4_Gp59_C; T4 gene Gp59 loader of gp41 DNA helicase C-term (PF08994; HMM-score: 15.1)
    DUF4517; Domain of unknown function (DUF4517) (PF15006; HMM-score: 14.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.106
    • Ymax_pos: 45
    • Cmax: 0.119
    • Cmax_pos: 20
    • Smax: 0.143
    • Smax_pos: 42
    • Smean: 0.095
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYSNVQPFINSDLTNCFQSQYTEIESLLFNLLDSPVKYTKHIGGTHHFKYSTEPILDILVGVENLHDITSLDEKRLNYVGFYRLHHKYTKKVMMAKFNNFHELKQQVRLHIIQMNTQTFESYLALDYLLSTNDDIALQFNTKKHQILQHSLTIRQYEMQKQQYFEKLCKKYL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]