From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0835 [new locus tag: SACOL_RS04300 ]
  • pan locus tag?: SAUPAN002699000
  • symbol: SACOL0835
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0835 [new locus tag: SACOL_RS04300 ]
  • symbol: SACOL0835
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 862387..863016
  • length: 630
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTCGAATCAAAATTACGACTACAATAAAAATGAAGATGGAAGTAAGAAGAAAATGAGT
    ACAACAGCGAAAGTAGTTAGCATTGCGACGGTATTGCTATTACTCGGAGGATTAGTATTT
    GCAATTTTTGCATATGTAGATCATTCGAATAAAGCTAAAGAACGTATGTTGAACGAACAA
    AAGCAGGAACAAAAAGAAAAGCGTCAAAAAGAAAATGCAGAAAAAGAGAGAAAGAAAAAG
    CAACAAGAGGAAAAAGAGCAGAATGAGCTAGATTCACAAGCAAACCAATATCAGCAATTG
    CCACAGCAGAATCAATATCAATATGTGCCACCTCAGCAACAAGCACCTACAAAGCAACGT
    CCTGCTAAAGAAGAGAATGATGATAAAGCATCAAAGGATGAGTCGAAAGATAAGGATGAC
    AAAGCATCTCAAGATAAATCAGATGATAATCAGAAGAAAACTGATGATAATAAACAACCA
    GCTCAGCCTAAACCACAGCCGCAACAACCAACACCAAAGCCAAATAATAATCAACAAAAC
    AATCAATCAAATCAGCAAGCAAAACCACAAGCACCACAACAAAATAGCCAATCAACAACA
    AATAAACAAAATAATGCTAATGATAAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    630

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0835 [new locus tag: SACOL_RS04300 ]
  • symbol: SACOL0835
  • description: hypothetical protein
  • length: 209
  • theoretical pI: 9.70055
  • theoretical MW: 24070
  • GRAVY: -1.97368

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein C (TIGR02978; HMM-score: 11.5)
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 3.5)
  • TheSEED:  
    FIG01107882: hypothetical protein 
  • PFAM:
    no clan definedDUF4887; Domain of unknown function (DUF4887) (PF16228; HMM-score: 171.7)
    DUF4199; Protein of unknown function (DUF4199) (PF13858; HMM-score: 20.7)
    DUF4574; Domain of unknown function (DUF4574) (PF15141; HMM-score: 18.6)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 15.2)
    no clan definedNeurensin; Neurensin (PF14927; HMM-score: 12.9)
    MaAIMP_sms; Putative methionine and alanine importer, small subunit (PF16951; HMM-score: 11.4)
    MFS (CL0015) TLC; TLC ATP/ADP transporter (PF03219; HMM-score: 9.8)
    GPCR_A (CL0192) 7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 6.9)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 6.9)
    MFS (CL0015) Acatn; Acetyl-coenzyme A transporter 1 (PF13000; HMM-score: 6.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.288
    • Ymax_pos: 42
    • Cmax: 0.209
    • Cmax_pos: 53
    • Smax: 0.541
    • Smax_pos: 36
    • Smean: 0.399
    • D: 0.332
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQRPAKEENDDKASKDESKDKDDKASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQNNQSNQQAKPQAPQQNSQSTTNKQNNANDK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cell wall associated [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL0835 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]