From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002699000
  • symbol?:
  • description?: DUF4887 domain-containing protein

      descriptions from strain specific annotations:

    • DUF4887 domain-containing protein
    • exported protein
  • strand?: +
  • coordinates?: 3191891..3192541
  • synteny block?: BlockID0019310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0748
    08BA02176:
    C248_0861
    11819-97:
    MS7_0821
    71193:
    ST398NM01_0849
    ECT-R 2:
    ECTR2_721
    ED133:
    SAOV_0811
    ED98:
    SAAV_0735
    HO 5096 0412:
    SAEMRSA15_06970
    JH1:
    SaurJH1_0811
    JH9:
    SaurJH9_0795
    JKD6008:
    SAA6008_00785
    JKD6159:
    SAA6159_00727
    LGA251:
    SARLGA251_07040
    M013:
    M013TW_0761
    MRSA252:
    SAR0826
    MSHR1132:
    SAMSHR1132_07160
    MSSA476:
    SAS0736
    Mu3:
    SAHV_0767
    Mu50:
    SAV0770
    MW2:
    MW0732
    RF122:
    SAB0726
    ST398:
    SAPIG0849
    T0131:
    SAT0131_00842
    TCH60:
    HMPREF0772_12408
    TW20:
    SATW20_08450
    USA300_TCH1516:
    USA300HOU_0799
    VC40:
    SAVC_03495

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQ
    N315            MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQ
    NCTC8325        MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQ
    Newman          MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQ
    USA300_FPR3757  MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQ
                    ************************************************************

    COL             KQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQR
    N315            KQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQR
    NCTC8325        KQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQR
    Newman          KQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQR
    USA300_FPR3757  KQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQNQYQYVPPQQQAPTKQR
                    ************************************************************

    COL             PAKEENDDKASKDESKDKDDKASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQN
    N315            PAKEENDDKASKDESKDKDDNASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQN
    NCTC8325        PAKEENDDKASKDESKDKDDKASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQN
    Newman          PAKEENDDKASKDESKDKDDKASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQN
    USA300_FPR3757  PAKEENDDKASKDESKDKDDKASQDKSDDNQKKTDDNKQPAQPKPQPQQPTPKPNNNQQN
                    ********************:***************************************

    COL             NQSNQQAKPQAPQQNSQSTTNKQNNANDK
    N315            NQSNQQAKPQAPQQNSQSTTNKQNNANDK
    NCTC8325        NQSNQQAKPQAPQQNSQSTTNKQNNANDK
    Newman          NQSNQQAKPQAPQQNSQSTTNKQNNANDK
    USA300_FPR3757  NQSNQQAKPQAPQQNSQSTTNKQNNANDK
                    *****************************