From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
  • pan locus tag?: SAUPAN002807000
  • symbol: SACOL0865
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
  • symbol: SACOL0865
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 891075..891335
  • length: 261
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAATAACATTTTGTTAAATGCTATCAATATAGTTATTACTACCACTTTTGTTATCTTT
    AATATTTTAATCACATATAATAAAGATTTAGATGATTTATGTTGGCTCCTGCCTGGTATT
    ATCATTTGTGGTGTGATACTCATCGTATCCTTTACCATTGCAATGATAACTAAAAACTGG
    TTAAGTGAAATATTATTTTTTATAAATATCGTACTCGTTCTCTATTACATTTATCCTATT
    TTTTATAGTTTTATAGGTTAA
    60
    120
    180
    240
    261

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
  • symbol: SACOL0865
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 4.06264
  • theoretical MW: 9940.02
  • GRAVY: 1.43837

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108213: hypothetical protein 
  • PFAM:
    no clan definedPhoLip_ATPase_C; Phospholipid-translocating P-type ATPase C-terminal (PF16212; HMM-score: 9.5)
    DUF1029; Protein of unknown function (DUF1029) (PF06269; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 12
    • Cmax: 0.142
    • Cmax_pos: 63
    • Smax: 0.24
    • Smax_pos: 7
    • Smean: 0.177
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]