From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002807000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 3272853..3273113
  • synteny block?: BlockID0019980
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0776
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2848
    ECT-R 2:
    ED133:
    SAOV_0838c
    ED98:
    SAAV_0767
    HO 5096 0412:
    SAEMRSA15_07240
    JH1:
    SaurJH1_0838
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00753
    LGA251:
    SARLGA251_07280
    M013:
    MRSA252:
    SAR0853
    MSHR1132:
    SAMSHR1132_07460
    MSSA476:
    SAS0762
    Mu3:
    SAHV_0817
    Mu50:
    SAV0821
    MW2:
    MW0775
    RF122:
    SAB0754c
    ST398:
    T0131:
    TCH60:
    HMPREF0772_12381
    TW20:
    SATW20_08710
    USA300_TCH1516:
    USA300HOU_0828
    VC40:
    SAVC_03635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNW
    N315            MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNW
    NCTC8325        MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNW
                    ************************************************************

    COL             LSEILFFINIVLVLYYIYPIFYSFIG
    N315            LSEILFFINIVLVLYYIYPIFYSFIG
    NCTC8325        LSEILFFINIVLVLYYIYPIFYSFIG
                    **************************