From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1036 [new locus tag: SACOL_RS05285 ]
  • pan locus tag?: SAUPAN003215000
  • symbol: SACOL1036
  • pan gene symbol?:
  • synonym:
  • product: protease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1036 [new locus tag: SACOL_RS05285 ]
  • symbol: SACOL1036
  • product: protease
  • replicon: chromosome
  • strand: +
  • coordinates: 1044994..1045596
  • length: 603
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATAAAATCTCGAAGGCTTTAACTTGGTTTATTATAAGTTTCATTATATTTCATCTC
    ATATTATTTATTATGTGGGGCGAACACCAAGAATACTGGTATTTATATACAGGTATAATG
    CTAATTGCTGGTATCAGTTATGTATTTTATCAAAGAGATATTGAATCTAATCGGTTGCTT
    ACATCAATTGGTGTTGGTATTATTACGGCAATTATTTTAATTATGCTTCAACTTTTATTC
    TCACTTATAACTTCTAATTTAAGTTATAGTTCATTAATTAAAGAATTAGCAAGAACAGGT
    GTCAATTGGAAGTGGCAAATGTTAGTAACTTTACTTTTTGTCATTCCATGTCACGAGTTA
    TATATGAGAACTGTTTTACAAAAAGAATTAACACATTTTTCAATACCGAAATGGGTAGCT
    ATATTAATAACTGCAATTTGTTCTAGTTCATTATTTATTTATTTAGATAATTGGTGGATA
    GTAACATTTATATTTGTTGCACAAGTGATATTATCATTAAGTTATGAGTATACTCGACGT
    ATAGCAACAACATCCGTTGCACAAATTGTAGCTATTATATTGTTATTAATTTTTAATGCT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1036 [new locus tag: SACOL_RS05285 ]
  • symbol: SACOL1036
  • description: protease
  • length: 200
  • theoretical pI: 8.98277
  • theoretical MW: 23288.8
  • GRAVY: 0.9475

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 10.5)
  • TheSEED:  
    FIG01108537: hypothetical protein 
  • PFAM:
    Peptidase_U (CL0472) Abi; CAAX protease self-immunity (PF02517; HMM-score: 29.7)
    no clan definedDUF2970; Protein of unknown function (DUF2970) (PF11174; HMM-score: 13.5)
    ATP_synthase (CL0255) ATP-synt_8; ATP synthase protein 8 (PF00895; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 11
    • Cmax: 0.128
    • Cmax_pos: 30
    • Smax: 0.238
    • Smax_pos: 2
    • Smean: 0.17
    • D: 0.148
  • predicted transmembrane helices (TMHMM): 7

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESNRLLTSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHELYMRTVLQKELTHFSIPKWVAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRRIATTSVAQIVAIILLLIFNA

Experimental data[edit source | edit]

  • experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]