From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1070 [new locus tag: SACOL_RS05455 ]
  • pan locus tag?: SAUPAN003270000
  • symbol: qoxB
  • pan gene symbol?: qoxA
  • synonym:
  • product: quinol oxidase subunit II

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1070 [new locus tag: SACOL_RS05455 ]
  • symbol: qoxB
  • product: quinol oxidase subunit II
  • replicon: chromosome
  • strand: -
  • coordinates: 1079066..1080166
  • length: 1101
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    GTGTCAAAATTTAAGTCTTTGCTTCTATTATTTGGCACACTAATTTTACTTAGTGGTTGT
    TCAAATATAGAAATTTTCAACGCAAAAGGGCCAGTAGCAAGTAGTCAGAAGTTCTTGATT
    CTTTATTCAATCGTCTTCATGCTTGTTATTTGTTTCGTTGTACTTGGCATGTTCGCCATT
    TTTATTTACAAGTATAGTTATAATAAGAATGCCGAATCTGGTAAGATGCACCATAATGCC
    ATCATTGAAACAATATGGTTTGTAATACCTATCATAATCGTTGCTGCTTTAGCTATTCCT
    ACAGTTAAAACTTTATACGATTACGAAAAACCACCGAAGAGTGAGAAAGATCCAATGGTT
    GTATATGCAGTAAGTGCAGGATACAAATGGTTCTTTGCTTATCCAGATGAACATATAGAG
    ACTGTTAATACATTAACAATCCCTAAAGATCGTCCTGTTGTATTTAAGCTTCAAGCTATG
    GATACAATGACAAGTTTCTGGATTCCACAATTAGGTGGTCAAAAATATGCCATGACTGGC
    ATGACAATGAATTGGACGTTAGAAGCATCTCAAACTGGTACGTTCAGAGGTCGTAACTCT
    AACTTCAATGGTGAAGGATTCTCACGTCAAACATTTAAAGTAAATGCCGTTAGTCAAAAA
    GACTACGACAAATGGGTGAAAGAAGTTAAAGGTAAGAAAACGTTAGATCAAGATACATTT
    GATAAACAATTATTACCAAGCACACCTAATAAAGCTTTAGAATTTAATGGTACACATATG
    GCGTTTGTTGATCCAGCAGCCGATCCAGAATACATCTTCTATGCATATAAACGTTTCAAT
    TTCGAATTGAAAGATCCAAACTTCACTAGTGAAGAAAATATGTTTAAAGATGTATCAGAC
    AAACCATTAATACCTGCTCGTAAAGCTCAAATTACAAATGCGAACTATAAACGACATGGT
    ATGAAGTTGATGATTCTTGGAAATGACGAACCATATAACAATGAGTTCAAGAAAGATGAA
    TCGAAAAATGCGAAAGAAATGAAGAAAATTTCAAAAGATGCGCAAGATCAAGACAATGAT
    GATCATGGAGGTGGACATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1101

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1070 [new locus tag: SACOL_RS05455 ]
  • symbol: QoxB
  • description: quinol oxidase subunit II
  • length: 366
  • theoretical pI: 9.00291
  • theoretical MW: 41776.8
  • GRAVY: -0.337158

Function[edit source | edit]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    Ubiquinol-8 + O2 = Ubiquinone-8 + H2O?
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportcytochrome aa3 quinol oxidase, subunit II (TIGR01432; EC 1.10.3.-; HMM-score: 430.2)
    MetabolismEnergy metabolismElectron transportubiquinol oxidase, subunit II (TIGR01433; EC 1.10.3.-; HMM-score: 181.3)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 135.6)
  • TheSEED:  
    Terminal cytochrome C oxidases AA3-600 quinol oxidase subunit II 
  • PFAM:
    no clan definedCOX2_TM; Cytochrome C oxidase subunit II, transmembrane domain (PF02790; HMM-score: 44.7)
    CU_oxidase (CL0026) COX2; Cytochrome C oxidase subunit II, periplasmic domain (PF00116; HMM-score: 23.8)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 17.8)
    CU_oxidase (CL0026) Cupredoxin_1; Cupredoxin-like domain (PF13473; HMM-score: 13.4)
    no clan definedBac_export_2; FlhB HrpN YscU SpaS Family (PF01312; HMM-score: 12.3)
    HRG; Haem-transporter, endosomal/lysosomal, haem-responsive gene (PF16954; HMM-score: 11.3)
    Bunya_G2; Bunyavirus glycoprotein G2 (PF03563; HMM-score: 9.9)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.7)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.8)
    no clan definedRELT; Tumour necrosis factor receptor superfamily member 19 (PF12606; HMM-score: 7.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane(Lipid modified N-termini)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILLSGCS
  • SignalP: no predicted signal peptide
    • Ymax: 0.338
    • Ymax_pos: 29
    • Cmax: 0.27
    • Cmax_pos: 29
    • Smax: 0.713
    • Smax_pos: 1
    • Smean: 0.53
    • D: 0.413
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]