From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003270000
  • symbol?: qoxA
  • description?: quinol oxidase polypeptide II QoxA

      descriptions from strain specific annotations:

    • quinol oxidase polypeptide II QoxA
    • quinol oxidase AA3, subunit II
    • quinol oxidase, subunit II
    • cytochrome aa3 quinol oxidase subunit II
    • quinol oxidase AA3 subunit II
    • putative quinol oxidase polypeptide IIprecursor
    • quinol oxidase subunit 2
    • quinol oxidase subunit 2 (Quinol oxidasepolypeptide II) (Quinol oxidase aa3-600, subunit QoxA) (Oxidase aa(3)-600 subunit 2)
  • strand?: -
  • coordinates?: 3647873..3648973
  • synteny block?: BlockID0023540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1070 (qoxB)
    N315:
    NCTC8325:
    Newman:
    NWMN_0930 (qoxA)
    USA300_FPR3757:
    04-02981:
    SA2981_1015 (qoxA)
    08BA02176:
    C248_1086 (qoxA)
    11819-97:
    MS7_1018 (qoxA)
    71193:
    ST398NM01_1058
    ECT-R 2:
    ECTR2_916 (qoxA)
    ED133:
    SAOV_1007c
    ED98:
    SAAV_1025 (qoxB)
    HO 5096 0412:
    SAEMRSA15_08920 (qoxA)
    JH1:
    SaurJH1_1143
    JH9:
    SaurJH9_1120
    JKD6008:
    SAA6008_01016 (qoxA)
    JKD6159:
    SAA6159_00917 (qoxA)
    LGA251:
    SARLGA251_09750 (qoxA)
    M013:
    M013TW_0992
    MRSA252:
    SAR1034 (qoxA)
    MSHR1132:
    SAMSHR1132_09090
    MSSA476:
    SAS0996
    Mu3:
    SAHV_1053
    Mu50:
    SAV1061
    MW2:
    MW0944
    RF122:
    SAB0927c (qoxA)
    ST398:
    SAPIG1058
    T0131:
    SAT0131_01096
    TCH60:
    HMPREF0772_12173 (qoxA)
    TW20:
    SATW20_10570 (qoxA)
    USA300_TCH1516:
    USA300HOU_1005 (qoxA)
    VC40:
    SAVC_04470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAI
    N315            MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAI
    NCTC8325        MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAI
    Newman          MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAI
    USA300_FPR3757  MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAI
                    ************************************************************

    COL             FIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMV
    N315            FIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMV
    NCTC8325        FIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMV
    Newman          FIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMV
    USA300_FPR3757  FIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMV
                    ************************************************************

    COL             VYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTG
    N315            VYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTG
    NCTC8325        VYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTG
    Newman          VYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTG
    USA300_FPR3757  VYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTG
                    ************************************************************

    COL             MTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTF
    N315            MTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTF
    NCTC8325        MTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTF
    Newman          MTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTF
    USA300_FPR3757  MTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTF
                    ************************************************************

    COL             DKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSD
    N315            DKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSD
    NCTC8325        DKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSD
    Newman          DKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSD
    USA300_FPR3757  DKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSD
                    ************************************************************

    COL             KPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDND
    N315            KPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDND
    NCTC8325        KPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDND
    Newman          KPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDND
    USA300_FPR3757  KPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDND
                    ************************************************************

    COL             DHGGGH
    N315            DHGGGH
    NCTC8325        DHGGGH
    Newman          DHGGGH
    USA300_FPR3757  DHGGGH
                    ******