From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1084 [new locus tag: SACOL_RS05530 ]
  • pan locus tag?: SAUPAN003289000
  • symbol: SACOL1084
  • pan gene symbol?: thiX
  • synonym:
  • product: cobalt transport family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1084 [new locus tag: SACOL_RS05530 ]
  • symbol: SACOL1084
  • product: cobalt transport family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1094421..1095227
  • length: 807
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGTATGAGCAATGGAAAGTTCGGCAATCATTTGTTGATGATGTCAACATTATAACGAAA
    CTATTTCTTGGAATTATACTATTTTTCTTTATTATATTTGTGCATAATTTCGATTTTATG
    CTTTATATCACTATCTTAATGTTAGTTTTCTTATTGATGTTTAATGGTACTCAGTTTAAA
    ATTACAGCAATTTTTATAACTATAAGTATTGGCTTTGCATTACTCTCTTCCCTGTTCATG
    ATTTTATACGGGAATGGTAGCCATACAATTTTGAAATTCGGATTTATCCATATTACAACA
    GAAAGTTTAGTTCGTGGTTTACATGTATCATTAAGAACCATTGCTATTTCATTTTTCGGT
    ATCTTAATCGCACTTACATCTCAGGTTGTCATGATATTTTATAGTTTAATGCAACATTTA
    AAGGTTAAATCAAAAGTTGCTTATGCATTCATGGCTGCCATTCGTATGATACCTTTAATG
    ATTAGTTCTTTAATACAGCTTCGCAGATCTTTAAAAATGCGCTATCAGATGATAGACGCG
    GCAAATTATAGAGGGTTAAAGCGATTTAAGCATTTAATTATACCTCTATTAAGCCAAAAT
    ATTAGAAAGGCACATCAATTATCAGTTGCGATGGAGTCGAAAGGATTTAGAGATGGTCCT
    CGTACTTACTATTACAACGTACCTTTCTCATATAAAGATATAATCTTTATTATAGTTTTA
    ATTGCCATTATTACTATGGCATATTATTGTTCAATCACCTTACCCATCACGGGCATAGAT
    GATGTTCGTCTTGGTCGTGTAGGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    807

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1084 [new locus tag: SACOL_RS05530 ]
  • symbol: SACOL1084
  • description: cobalt transport family protein
  • length: 268
  • theoretical pI: 10.5187
  • theoretical MW: 30953.2
  • GRAVY: 0.758582

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ECF transporter T component CbiQ (TIGR02454; HMM-score: 53.8)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCofactors, Vitamins, Prosthetic Groups, Pigments - no subcategoryThiamin biosynthesis Transmembrane component YkoC of energizing module of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine 
    Membrane TransportMembrane Transport - no subcategoryECF class transporters Transmembrane component YkoC of energizing module of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine 
  • PFAM:
    no clan definedCbiQ; Cobalt transport protein (PF02361; HMM-score: 82.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.09
    • Ymax_pos: 70
    • Cmax: 0.117
    • Cmax_pos: 61
    • Smax: 0.107
    • Smax_pos: 61
    • Smean: 0.042
    • D: 0.071
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFNGTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIAISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRYQMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDIIFIIVLIAIITMAYYCSITLPITGIDDVRLGRVG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]