From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1358 [new locus tag: SACOL_RS06915 ]
  • pan locus tag?: SAUPAN003696000
  • symbol: SACOL1358
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1358 [new locus tag: SACOL_RS06915 ]
  • symbol: SACOL1358
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1363806..1364660
  • length: 855
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGTCTTTTTATGTTGTACTTATCATTATCATTGTAGCATTAATTGGTATATTAGTTTTA
    AATCAAAGGTATAGTAATAGTAAAATAGATACCGAAGTTTATGCAAGAAAGCAACTTATT
    AAAAAGAACAAAGCATTAAGTGCAGAAAATGCTGAATTAAGAAGTCAAATGCTGAGTTCT
    AATAATGATGTTGGCCACCATGCATACAAAAATGCTAAAAGAGAATTACGCAAGATTTTA
    GATAGCTATCTCGAAAATGGTAAATTAAAATATTACGATATTATCGTTACAAGCAATTTA
    GCTACTAAACATCCGTTTTTCGAGTATGCACGTTCATTTGATTTTATCATTGTTTCAGAT
    ATCGGTTTAATAAACGTTGATGTAAAAAGCTGGGGTGAAAAAACATTTTATCACTTTGAT
    GTACCTGATGAGCATGATACAGAAATAAGCAATAGTAATATTGAAAAAGTTGTCGGTCAT
    TACATTAGCCAGCAATATCATGATCAGTTTAATTCATCAAGAAAGTCTATCTATACTTTT
    ACAGAAACAGTTCAACCAAATCGTGTTATTTATGATTTTTATGATTATGATCCGTATCAA
    TTAGCAGCAAATAATGCGAAAGCATTAAAGGATCATATTGAACAAAACTTTAACTTTAAA
    GTCCAAAGTACCGGTGTTATTTACTTTAGTGATGGTACAGTTAATATCATTCAAGGTTCT
    GAAGAAAGAGATAAATATGTTGATACAGTTTCAACAAAATCTTCGTTACGACGTATTATT
    AGCGAAGCCATAGAGCTATCTAAACACCCTTTAAATAAAGAACAGGTTGATCAAATCACA
    GCTATATTCAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    855

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1358 [new locus tag: SACOL_RS06915 ]
  • symbol: SACOL1358
  • description: hypothetical protein
  • length: 284
  • theoretical pI: 7.04044
  • theoretical MW: 32850.8
  • GRAVY: -0.402817

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 14.7)
  • TheSEED:  
    FIG01108654: hypothetical protein 
  • PFAM:
    PDDEXK (CL0236) NERD; Nuclease-related domain (PF08378; HMM-score: 21.7)
    AB_hydrolase (CL0028) Abhydrolase_4; TAP-like protein (PF08386; HMM-score: 15)
    no clan definedNYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 14.9)
    RNase_H (CL0219) OrfB_IS605; Probable transposase (PF01385; HMM-score: 14.6)
    no clan definedYabB; Initiation control protein YabA (PF06156; HMM-score: 14)
    SpoVIF; Stage VI sporulation protein F (PF14069; HMM-score: 12.8)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.262
    • Ymax_pos: 26
    • Cmax: 0.217
    • Cmax_pos: 26
    • Smax: 0.464
    • Smax_pos: 21
    • Smean: 0.276
    • D: 0.268
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSSNNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSDIGLINVDVKSWGEKTFYHFDVPDEHDTEISNSNIEKVVGHYISQQYHDQFNSSRKSIYTFTETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGSEERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL1358 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]