From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1369 [new locus tag: SACOL_RS06970 ]
  • pan locus tag?: SAUPAN003708000
  • symbol: rpmG
  • pan gene symbol?: rpmG2
  • synonym:
  • product: 50S ribosomal protein L33

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1369 [new locus tag: SACOL_RS06970 ]
  • symbol: rpmG
  • product: 50S ribosomal protein L33
  • replicon: chromosome
  • strand: +
  • coordinates: 1375408..1375557
  • length: 150
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    GTGCGCGTAAACGTAACATTAGCATGCACAGAATGTGGCGATCGTAACTATATCACTACT
    AAAAATAAACGTAATAATCCTGAGCGTATTGAAATGAAAAAATATTGCCCAAGATTAAAC
    AAATATACGTTACATCGTGAAACTAAGTAA
    60
    120
    150

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1369 [new locus tag: SACOL_RS06970 ]
  • symbol: RpmG
  • description: 50S ribosomal protein L33
  • length: 49
  • theoretical pI: 10.2418
  • theoretical MW: 5931.87
  • GRAVY: -1.26327

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL33 (TIGR01023; HMM-score: 76.3)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome LSU bacterial LSU ribosomal protein L33p 
    Ribosome LSU bacterial LSU ribosomal protein L33p, zinc-independent 
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 86.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.157
    • Ymax_pos: 19
    • Cmax: 0.108
    • Cmax_pos: 14
    • Smax: 0.28
    • Smax_pos: 8
    • Smean: 0.227
    • D: 0.185
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SACOL1611 (Zur*)
    Zur* (TF) important in Zinc homeostasis  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]