From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003708000
  • symbol?: rpmG2
  • description?: 50S ribosomal protein L33

      descriptions from strain specific annotations:

    • 50S ribosomal protein L33
    • 50S ribosomal protein L33p
  • strand?: +
  • coordinates?: 4012851..4013009
  • synteny block?: BlockID0027740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1369 (rpmG)
    N315:
    SAS042 (rpmG)
    NCTC8325:
    Newman:
    NWMN_1247 (rpmG)
    USA300_FPR3757:
    04-02981:
    SA2981_1290 (rpmG)
    08BA02176:
    C248_1371 (rpmG2)
    11819-97:
    MS7_1294
    71193:
    ST398NM01_1337
    ECT-R 2:
    ECTR2_1194 (rpmG)
    ED133:
    SAOV_1348
    ED98:
    SAAV_1315 (rpmG)
    HO 5096 0412:
    SAEMRSA15_11820 (rpmG2)
    JH1:
    SaurJH1_1423 (rpmG)
    JH9:
    SaurJH9_1396 (rpmG)
    JKD6008:
    SAA6008_01301 (rpmG_1)
    JKD6159:
    SAA6159_01202 (rpmG_1)
    LGA251:
    SARLGA251_12440 (rpmG2)
    M013:
    M013TW_1283
    MRSA252:
    SAR1345 (rpmG)
    MSHR1132:
    SAMSHR1132_11800
    MSSA476:
    SAS1275 (rpmG)
    Mu3:
    SAHV_1324 (rpmG)
    Mu50:
    SAV1335 (rpmG)
    MW2:
    MW1222 (rpmG)
    RF122:
    SAB1193 (rpmG)
    ST398:
    SAPIG1337 (rpmG)
    T0131:
    SAT0131_01406
    TCH60:
    HMPREF0772_11873 (rpmG2)
    TW20:
    SATW20_13370 (rpmG2)
    USA300_TCH1516:
    USA300HOU_1278 (rpmG)
    VC40:
    SAVC_05915 (rpmG)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
    N315            MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
    NCTC8325        MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
    Newman          MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
    USA300_FPR3757  MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
                    *************************************************