From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004133000
  • symbol?: pbp3
  • description?: penicillin-binding protein 3

      descriptions from strain specific annotations:

    • penicillin-binding protein 3
    • Cell division protein FtsI [Peptidoglycan synthetase] / Transpeptidase, Penicillin binding protein transpeptidase domain, Penicillin-binding protein 3
    • penicillin binding transpeptidase domain protein
    • penicillin-binding protein PBP2B
    • cell division protein FtsI
    • penicillin-binding Protein dimerisation domain family
  • strand?: -
  • coordinates?: 4400610..4402685
  • synteny block?: BlockID0031630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1609 (pbp3)
    N315:
    SA1381 (pbp3)
    NCTC8325:
    Newman:
    NWMN_1455 (pbpC)
    USA300_FPR3757:
    04-02981:
    SA2981_1510 (ftsI)
    08BA02176:
    C248_1595 (pbpF)
    11819-97:
    MS7_1569
    71193:
    ST398NM01_1617
    ECT-R 2:
    ECTR2_1402
    ED133:
    SAOV_1552
    ED98:
    SAAV_1544 (pbp3)
    HO 5096 0412:
    SAEMRSA15_14720 (pbpF)
    JH1:
    SaurJH1_1644
    JH9:
    SaurJH9_1610
    JKD6008:
    SAA6008_01521 (pbp3)
    JKD6159:
    SAA6159_01487 (pbp3)
    LGA251:
    SARLGA251_14580 (pbpF)
    M013:
    M013TW_1567
    MRSA252:
    SAR1629 (pbpF)
    MSHR1132:
    SAMSHR1132_13920
    MSSA476:
    SAS1490
    Mu3:
    SAHV_1539 (pbp3)
    Mu50:
    SAV1552 (pbp3)
    MW2:
    MW1504 (pbp3)
    RF122:
    SAB1424c (pbpF)
    ST398:
    SAPIG1617
    T0131:
    SAT0131_01646 (ipk)
    TCH60:
    HMPREF0772_11588 (pbp3)
    TW20:
    SATW20_15480 (pbpF)
    USA300_TCH1516:
    USA300HOU_1554 (pbp3)
    VC40:
    SAVC_07010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKRLKEKSNDEIVQNTINKRINFIFGVIVFIFAVLVLRLGYLQIAQGSHYKQIIKNDEN
    N315            MLKRLKEKSNDEIVQNTINKRINFIFGVIVFIFAVLVLRLGYLQIAQGSHYKQIIKNDEN
    NCTC8325        MLKRLKEKSNDEIVQNTINKRINFIFGVIVFIFAVLVLRLGYLQIAQGSHYKQIIKNDEN
    Newman          MLKRLKEKSNDEIVQNTINKRINFIFGVIVFIFAVLVLRLGYLQIAQGSHYKQIIKNDEN
    USA300_FPR3757  MLKRLKEKSNDEIVQNTINKRINFIFGVIIFIFAVLVLRLGYLQIAQGSHYKQIIKNDEN
                    *****************************:******************************

    COL             ITVNESVPRGRILDRNGKVLVDNASKMAITYTRGRKTTQSEMLDTAEKLSKLIKMDTKKI
    N315            ITVNESVPRGRILDRNGKVLVDNASKMAITYTRGRKTTQSEMLDTAEKLSKLIKMDTKKI
    NCTC8325        ITVNESVPRGRILDRNGKVLVDNASKMAITYTRGRKTTQSEMLDTAEKLSKLIKMDTKKI
    Newman          ITVNESVPRGRILDRNGKVLVDNASKMAITYTRGRKTTQSEMLDTAEKLSKLIKMDTKKI
    USA300_FPR3757  ITVNESVPRGRILDRNGKVLVDNASKMAITYTRGRKTTQSEMLDTAEKLSKLIKMDTKKI
                    ************************************************************

    COL             TERDKKDFWIQLHPKKAKAMMTKEQAMLADGSIKQDQYDKQLLSKIGKSQLDELSSKDLQ
    N315            TERDKKDFWIQLHPKKAKAMMTKEQAMLADGSIKQDQYDKQLLSKIGKSQLDELSSKDLQ
    NCTC8325        TERDKKDFWIQLHPKKAKAMMTKEQAMLADGSIKQDQYDKQLLSKIGKSQLDELSSKDLQ
    Newman          TERDKKDFWIQLHPKKAKAMMTKEQAMLADGSIKQDQYDKQLLSKIGKSQLDELSSKDLQ
    USA300_FPR3757  TERDKKDFWIQLHPKKAKAMMTKEQAMLADGSIKQDQYDKQLLSKIGKSQLDELSSKDLQ
                    ************************************************************

    COL             VLAIFREMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRG
    N315            VLAIFREMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRG
    NCTC8325        VLAIFREMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRG
    Newman          VLAIFREMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRG
    USA300_FPR3757  VLAIFREMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRG
                    ************************************************************

    COL             IFGDVSTPAEGIPKELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGK
    N315            IFGDVSTPAEGIPKELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGK
    NCTC8325        IFGDVSTPAEGIPKELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGK
    Newman          IFGDVSTPAEGIPKELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGK
    USA300_FPR3757  IFGDVSTPAEGIPKELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGK
                    ************************************************************

    COL             VTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKKLRSQGAKDMDNAMMVVQNPKNG
    N315            VTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKKLRSQGAKDMDNAMMVVQNPKNG
    NCTC8325        VTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKKLRSQGAKDMDNAMMVVQNPKNG
    Newman          VTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKKLRSQGAKDMDNAMMVVQNPKNG
    USA300_FPR3757  VTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKKLRSQGAKDMDNAMMVVQNPKNG
                    ************************************************************

    COL             DILALAGKQINKSGKMTDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLH
    N315            DILALAGKQINKSGKMTDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLH
    NCTC8325        DILALAGKQINKSGKMTDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLH
    Newman          DILALAGKQINKSGKMTDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLH
    USA300_FPR3757  DILALAGKQINKSGKMTDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLH
                    ************************************************************

    COL             FQGGLTKRSYFNKNGHVTINDKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQ
    N315            FQGGLTKRSYFNKNGHVSINDKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQ
    NCTC8325        FQGGLTKRSYFNKNGHVTINDKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQ
    Newman          FQGGLTKRSYFNKNGHVTINDKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQ
    USA300_FPR3757  FQGGLTKRSYFNKNGHVTINDKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQ
                    *****************:******************************************

    COL             KLRRGLNQVGLGVKTGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTI
    N315            KLRRGLNQVGLGVKTGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTI
    NCTC8325        KLRRGLNQVGLGVKTGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTI
    Newman          KLRRGLNQVGLGVKTGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTI
    USA300_FPR3757  KLRRGLNQVGLGVKTGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTI
                    ************************************************************

    COL             ANDGYRIQPHIGLTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDK
    N315            ANDGYRIQPHIGLTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDK
    NCTC8325        ANDGYRIQPHIGLTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDK
    Newman          ANDGYRIQPHIGLTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDK
    USA300_FPR3757  ANDGYRIQPHIGLTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDK
                    ************************************************************

    COL             DGTGYVSFKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPP
    N315            DGTGYVSFKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPP
    NCTC8325        DGTGYVSFKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPP
    Newman          DGTGYVSFKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPP
    USA300_FPR3757  DGTGYVSFKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPP
                    ************************************************************

    COL             PWLTGGDLGRDVINYYFKQLGKDDKNKDKDK
    N315            PWLTGGDLGRDVINYYFKQLGKDDKNKDKDK
    NCTC8325        PWLTGGDLGRDVINYYFKQLGKDDKNKDKDK
    Newman          PWLTGGDLGRDVINYYFKQLGKDDKNKDKDK
    USA300_FPR3757  PWLTGGDLGRDVINYYFKQLGKNDKNKDKDK
                    **********************:********