From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004132000
  • symbol?: rpmG
  • description?: 50S ribosomal protein L33

      descriptions from strain specific annotations:

    • 50S ribosomal protein L33
    • 50S ribosomal protein L33p
    • 50S ribosomal protein L33 type 1
  • strand?: -
  • coordinates?: 4400347..4400496
  • synteny block?: BlockID0031620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1608 (rpmG)
    N315:
    SAS047 (rpmG)
    NCTC8325:
    Newman:
    NWMN_1454 (rpmG)
    USA300_FPR3757:
    04-02981:
    SA2981_1509 (rpmG)
    08BA02176:
    C248_1594 (rpmG1)
    11819-97:
    MS7_1568
    71193:
    ST398NM01_1616
    ECT-R 2:
    ECTR2_1401 (rpmG)
    ED133:
    SAOV_1551 (rpmG_2)
    ED98:
    SAAV_1543 (rpmG_1)
    HO 5096 0412:
    SAEMRSA15_14710 (rpmG1)
    JH1:
    SaurJH1_1643 (rpmG)
    JH9:
    SaurJH9_1609 (rpmG)
    JKD6008:
    SAA6008_01520 (rpmG)
    JKD6159:
    SAA6159_01486 (rpmG)
    LGA251:
    SARLGA251_14570 (rpmG1)
    M013:
    M013TW_1566
    MRSA252:
    SAR1628 (rpmG)
    MSHR1132:
    SAMSHR1132_13910
    MSSA476:
    SAS1489 (rpmG)
    Mu3:
    SAHV_1538 (rpmG)
    Mu50:
    SAV1551 (rpmG)
    MW2:
    MW1503 (rpmG)
    RF122:
    SAB1423c (rpmG)
    ST398:
    SAPIG1616 (rpmG)
    T0131:
    SAT0131_01645
    TCH60:
    HMPREF0772_11589 (rpmG)
    TW20:
    SATW20_15470 (rpmG1)
    USA300_TCH1516:
    USA300HOU_1553 (rpmG)
    VC40:
    SAVC_07005 (rpmG)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
    N315            MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
    NCTC8325        MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
    Newman          MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
    USA300_FPR3757  MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
                    *************************************************