From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • pan locus tag?: SAUPAN003715000
  • symbol: SACOL1375
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • symbol: SACOL1375
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1379598..1379831
  • length: 234
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
    GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACATTAGTGCTCACTCGGAACAAGTGTAC
    GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
    CCTACAAACAATAGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • symbol: SACOL1375
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 7.76467
  • theoretical MW: 8861.94
  • GRAVY: -0.292208

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01107901: hypothetical protein 
  • PFAM:
    Trigger_C (CL0262) SurA_N_3; SurA N-terminal domain (PF13624; HMM-score: 13.6)
    no clan definedDUF3674; RNA dependent RNA polymerase (PF12426; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: AIFLLSAN
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.453
    • Ymax_pos: 25
    • Cmax: 0.294
    • Cmax_pos: 25
    • Smax: 0.865
    • Smax_pos: 34
    • Smean: 0.596
    • D: 0.509
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNSEQRDGKVFALIN

Experimental data[edit source | edit]

  • experimental localization: Signal peptide containing [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]