From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003715000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 4017301..4017612
  • synteny block?: BlockID0027810
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1295
    08BA02176:
    C248_1376
    11819-97:
    MS7_1299
    71193:
    ST398NM01_1342
    ECT-R 2:
    ECTR2_1199
    ED133:
    SAOV_1353
    ED98:
    SAAV_1321
    HO 5096 0412:
    SAEMRSA15_11870
    JH1:
    SaurJH1_1428
    JH9:
    SaurJH9_1401
    JKD6008:
    SAA6008_01306
    JKD6159:
    SAA6159_01207
    LGA251:
    SARLGA251_12490
    M013:
    M013TW_1288
    MRSA252:
    SAR1350
    MSHR1132:
    SAMSHR1132_11850
    MSSA476:
    SAS1280
    Mu3:
    SAHV_1329
    Mu50:
    SAV1340
    MW2:
    MW1227
    RF122:
    SAB1198
    ST398:
    SAPIG1342
    T0131:
    SAT0131_01411 (narJ)
    TCH60:
    HMPREF0772_11868
    TW20:
    SATW20_13420
    USA300_TCH1516:
    VC40:
    SAVC_05940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKD
    N315            MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANVSAHSEQVYEMTDHQIKNNTINKAYEHKD
    NCTC8325        MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKD
    Newman          MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKD
                    *******************************:****************************

    COL             PTNNSEQRDGKVFALIN
    N315            PTNNGEQRDGKVFALIN
    NCTC8325        PTNNSEQRDGKVFALIN
    Newman          PTNNSEQRDGKVFALIN
                    ****.************