From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1416 [new locus tag: SACOL_RS07205 ]
  • pan locus tag?: SAUPAN003786000
  • symbol: SACOL1416
  • pan gene symbol?: opp-2C
  • synonym:
  • product: peptide ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1416 [new locus tag: SACOL_RS07205 ]
  • symbol: SACOL1416
  • product: peptide ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 1426938..1427768
  • length: 831
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCATAAAATATTTTCAAAGAATAACCTGATATTTTTTGTATTCGTTGCATTTATTTTT
    GTGGTAATTGTACTGCAATTCTTTGTCAGTAGTGAAAATGCAACCAAAGTCAATTTATCA
    CAAACTTTTGAACCTATTAGTTGGTTGCATTTATTAGGAACTGATGATTATGGGAGAGAT
    TTATTTACCCGAATTATTATCGGTGCACGTTCAACATTGTTTGTTACTGTTTTAACATTA
    ATAGCTATCGTTGTCATAGGTGTTACACTAGGTCTATTTGCCGGATACAAAAAAGGGTGG
    ATTGAACGATTAGTGTTAAGGTTTATTGATGTTGGTCTAAGTATTCCAGAATTTATCATC
    ATGATTGCTTTAGCAAGTTTTTTTCAACCATCTTTATGGAATTTAGTTATCTCAATTACA
    TTAATAAAATGGATGAATTACACAAGGTTGACTAGAAGTATAGTTAATAGCGAAATGAAT
    AAGCCTTATATAAAAATGGCACAATTATTTCATGTACCAACAAGAACAATATTAATACGT
    CATTTAACACCTAAAATTATACCGGCTATTATCGTTTTGATGGTCGTTGATTTCGGTAAA
    ATCATTCTATATATAAGTTCACTATCATTTATTGGGTTAGGTGCACAACCGCCAACACCA
    GAGTGGGGCGCTATGTTGCAACAAGGTCGTGATTTTATTTCGTCTCATCCAATTATGTTG
    ATTGCACCTGCTTCAGTCATTGCTATAACTATTTTAATTTTTAATTTAACCGGTGATGCA
    CTAAGAGATAGATTGCTGAAACAACGGGGTGAATATGATGAGTCTCATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1416 [new locus tag: SACOL_RS07205 ]
  • symbol: SACOL1416
  • description: peptide ABC transporter permease
  • length: 276
  • theoretical pI: 10.2524
  • theoretical MW: 31255.1
  • GRAVY: 0.687319

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikC (TIGR02790; EC 3.6.3.24; HMM-score: 247.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikB (TIGR02789; EC 3.6.3.24; HMM-score: 22.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesamino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 18.6)
  • TheSEED:  
    ABC-type dipeptide/oligopeptide/nickel transport system, permease component 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 94.5)
    no clan definedDHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 6.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.295
    • Ymax_pos: 34
    • Cmax: 0.204
    • Cmax_pos: 40
    • Smax: 0.646
    • Smax_pos: 28
    • Smean: 0.409
    • D: 0.34
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRDLFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Aurelia Hiron, Brunella Posteraro, Marie Carrière, Laetitia Remy, Cécile Delporte, Marilena La Sorda, Maurizio Sanguinetti, Vincent Juillard, Elise Borezée-Durant
A nickel ABC-transporter of Staphylococcus aureus is involved in urinary tract infection.
Mol. Microbiol.: 2010, 77(5);1246-60
[PubMed:20662775] [WorldCat.org] [DOI] (I p)